CAZyme Information: FVEG_13676-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_13676-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813		90018.93	6.1845

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000587.1:225446-228495(+)

Full Sequence      

MIPWTPWEFLDIYKETEQVFDDVKPDLTIVEPLFTQGLMFCHHRGAKWMVLSPNTIKEFA
VPVQPNLAALWKYPMQVAPPTTDENTLTDPSSACSALLYSIPWSLIPWNICFGFVAGYTL
LTDTRLKETTEILRRETDPSISLMTTMELGVLKPAPPNLPILYPTEAHEMSKALRKVLEY
ANTLHSAGKPVQILWKLGRVPDEEGNAPKRDCYTGEWALNIICSLSHGGANSFYEALCSG
IPQALLPAWTDCYDFANRVELLGIGLWANKEAKPRWKDDELANALLEILFGPESAGMRVR
AAEVASRHPEWKGRQMASQEILKIEGSATSARLSEEKRLGKIGSASHSPQLNFNTSQIHQ
NHQEIHHLNMADEVEPKRLSQPFSIPDPTSFSNFQRDIYQSFRPPLFSTNPTEWESLAKE
KIPATNFGYVYGSASSAATAKANSEAFGRYRLKPRFLVDVTTRDVDVELFGTKYKSPLLV
APIGVQSILHPDAEEATARACHNVGMPMILSTAATRTIEEVAAANADGDRWYQLYWPKPQ
FEEVTASLLARAKASGYKVLVVTLDTFSLGWRPTDLDTSYLPFIWGQGCQIGFSDPVFNK
LFDEMQKNDSRGIAEKLSELWTIMRRPGTVYGAARVLANAKTLIKSKAWIDVINSGTYRS
WNDLKILKDLWDGPIVLKGIQTVEDAHLAIEHGIDGIIVSNHGGRQLDGAIASLDALSDI
AADKKVKDSNLTIMFDSGARTGSDVLKALALGAKAVCIGRPYAYGLAAGGQEGVEHVLKC
LLADMDNMLANAGKKSVRDLSRDDLQILPLSKI

Enzyme Prediction     

No EC number prediction in FVEG_13676-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
239448	LMO_FMN	0.0	394	805	1	383	L-Lactate 2-monooxygenase (LMO) FMN-binding domain. LMO is a FMN-containing enzyme that catalyzes the conversion of L-lactate and oxygen to acetate, carbon dioxide, and water. LMO is a member of the family of alpha-hydroxy acid oxidases. It is thought to be a homooctamer with two- and four- fold axes in the center of the octamer.
395850	FMN_dh	1.63e-139	418	806	1	349	FMN-dependent dehydrogenase.
239203	alpha_hydroxyacid_oxid_FMN	1.73e-122	413	802	2	299	Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO). In green plants, glycolate oxidase is one of the key enzymes in photorespiration where it oxidizes glycolate to glyoxylate. LMO catalyzes the oxidation of L-lactate to acetate and carbon dioxide. MDH oxidizes (S)-mandelate to phenylglyoxalate. It is an enzyme in the mandelate pathway that occurs in several strains of Pseudomonas which converts (R)-mandelate to benzoate.
224223	LldD	8.59e-85	411	809	1	352	FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase [Energy production and conversion, Lipid transport and metabolism, General function prediction only].
240087	MDH_FMN	2.92e-83	413	802	2	361	Mandelate dehydrogenase (MDH)-like FMN-binding domain. MDH is part of a widespread family of homologous FMN-dependent a-hydroxy acid oxidizing enzymes that oxidizes (S)-mandelate to phenylglyoxalate. MDH is an enzyme in the mandelate pathway that occurs in several strains of Pseudomonas which converts (R)-mandelate to benzoate. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60995.1|GT1	3.18e-170	1	322	116	506
CCT74337.1|GT1	2.02e-168	1	322	116	506
QGJ00663.1|GT1	2.02e-168	1	322	116	506
QGI69774.1|GT1	2.02e-168	1	322	116	506
CEI70655.1|GT1	9.97e-132	1	322	116	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DVH_A	1.83e-76	389	806	2	391	Chain A, Lactate 2-monooxygenase [Mycolicibacterium smegmatis],6DVH_B Chain B, Lactate 2-monooxygenase [Mycolicibacterium smegmatis],6DVH_C Chain C, Lactate 2-monooxygenase [Mycolicibacterium smegmatis],6DVH_D Chain D, Lactate 2-monooxygenase [Mycolicibacterium smegmatis],6DVH_E Chain E, Lactate 2-monooxygenase [Mycolicibacterium smegmatis],6DVH_F Chain F, Lactate 2-monooxygenase [Mycolicibacterium smegmatis]
6DVI_A	4.94e-76	389	806	2	391	Chain A, Lactate 2-monooxygenase [Mycolicibacterium smegmatis],6DVI_B Chain B, Lactate 2-monooxygenase [Mycolicibacterium smegmatis],6DVI_C Chain C, Lactate 2-monooxygenase [Mycolicibacterium smegmatis],6DVI_D Chain D, Lactate 2-monooxygenase [Mycolicibacterium smegmatis],6DVI_E Chain E, Lactate 2-monooxygenase [Mycolicibacterium smegmatis],6DVI_F Chain F, Lactate 2-monooxygenase [Mycolicibacterium smegmatis]
1AL7_A	1.28e-62	409	805	4	354	Three-Dimensional Structures Of Glycolate Oxidase With Bound Active- Site Inhibitors [Spinacia oleracea],1AL8_A Three-Dimensional Structure Of Glycolate Oxidase With Bound Active- Site Inhibitors [Spinacia oleracea]
1GOX_A	1.73e-62	409	805	5	355	Refined Structure Of Spinach Glycolate Oxidase At 2 Angstroms Resolution [Spinacia oleracea]
1GYL_A	6.18e-62	409	805	4	354	Involvement Of Tyr24 And Trp108 In Substrate Binding And Substrate Specificity Of Glycolate Oxidase [Spinacia oleracea],1GYL_B Involvement Of Tyr24 And Trp108 In Substrate Binding And Substrate Specificity Of Glycolate Oxidase [Spinacia oleracea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0DUR7|QULF_PENCI	1.41e-109	388	803	3	387	FMN-dependent alpha-hydroxy acid dehydrogenase qulF OS=Penicillium citrinum OX=5077 GN=qulF PE=1 SV=1
sp|Q9HDX2|YKN3_SCHPO	2.49e-99	393	805	15	403	Uncharacterized lactate 2-monooxygenase PB1A11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB1A11.03 PE=3 SV=1
sp|P21795|LMO_MYCSM	2.54e-75	389	806	2	391	L-lactate 2-monooxygenase OS=Mycolicibacterium smegmatis OX=1772 PE=1 SV=3
sp|B1HZY7|LOX_LYSSC	7.70e-74	415	800	28	372	L-lactate oxidase OS=Lysinibacillus sphaericus (strain C3-41) OX=444177 GN=Bsph_0911 PE=1 SV=1
sp|B8B7C5|GLO5_ORYSI	1.70e-62	409	803	5	353	Glycolate oxidase 5 OS=Oryza sativa subsp. indica OX=39946 GN=GLO5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FVEG_13676-t26_1-p1.