CAZyme Information: FVEG_13657-t26_2-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_13657-t26_2-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
695		76933.27	6.6847

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000587.1:171330-173882(+)

Full Sequence      

MLTPSKYPTNGWWAPYAAPPGKGTAAGPFPYESSLDGFGIGFGIGQDRQFDGTSVKVPTQ
LDWRASFSEHSGEFDGHKARAFDTQTVTIQYFEGNSSMKAYLVPGSPYMTFQYKSATPRL
TTLNGGIKSLNSIALSGGNTVSHRGTKFTVIDTKGTTYLIYSDRSIKLTAEAENNNQGTL
SADGKFSGILRMVLLRDPNHQKLLDAHSKVYPISLSQDYSISGDSGTVTFKWKTKGTGDL
LMLTWPHHREVLQNPNSPGPSTLSYLTLKGWMYPTLGNIWRLTYKLTSITWNAPRDVDPS
CKESVVNGLKYEVDQLDPSKAPAPNEFYYWGGTLAAKSRLALIADHVGSKDLIDPVIKYL
KASFDNWFSATNKALPAYETTWGGVINKEGATNIWVDFGNGHFNDHHFHYGYFLHIAAVI
AKYDPNWLNAHREYVSFFARDIINPSSDDPFFPITRCLDWFAGHSWASGIANGAGSRDQE
SVGEAVNGYYGAMLWATVALGQEHANFARLLLAIEQQAAKKYWHLYPSAGKDDPMNPYPE
AKFRDLITVGNVMDWQTGAWLFWGAEKVQIAAIQILPVTPANEVMYDAEWVSNVFAYTMP
ELTNASYADSWKSVIYAAYSNAKPQEAAAWSANLSDWGSGNTYTNELYFISTRPNPSGQP
ICGALPQNPYGDYKIQATSGKYICLCSQCWDPAAH

Enzyme Prediction     

No EC number prediction in FVEG_13657-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	7	649	7.6e-120	0.9678456591639871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	3.22e-68	302	637	7	334	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	3.99e-65	97	644	192	746	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	5.05e-25	86	290	107	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT74359.1|GH81	0.0	7	683	61	737
QGI69792.1|GH81	0.0	7	683	61	754
QGI87134.1|GH81	0.0	7	683	61	754
QGJ00681.1|GH81	0.0	7	683	61	754
UKZ70759.1|GH81	0.0	7	683	70	749

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	4.44e-53	61	668	113	733	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.67e-53	61	668	138	758	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	9.70e-52	61	668	113	733	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.52e-36	8	627	36	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.54e-26	218	638	249	666	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	6.51e-49	78	643	121	694	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.04e-45	83	627	168	707	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|D4AZ24|ENG1_ARTBC	3.41e-39	78	630	318	873	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.34e-34	84	594	525	1054	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.84e-33	237	615	351	736	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000004

TMHMM  Annotations     

There is no transmembrane helices in FVEG_13657-t26_2-p1.