CAZyme Information: FVEG_13587-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_13587-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264		29649.40	8.3004

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000585.1:2857678-2858566(-)

Full Sequence      

MERREKPKDERVEAPSALNPIGNPALPGNTSSGGQNWATYMTTEFNTTLTLAYIFARSAS
VVDAEIIPSRSKSSFSFAQQIVHFQDAIGHRPHYAAWTEKNIVATVWFGFNDLSVVSHKR
GQGAILAAANRRIFELSQILYDTGIRNFIFIEIPPKELFPSHQAHKNNDTHHSYEMVSYA
VNRWNSLLRQNTVRFQKSHPDAKVTCVEIWDIFYEAFLRPQDLGAPNSNCVDPSGKGCLW
ANTGHPGEKIHQLIGARVAEKAWG

Enzyme Prediction     

No EC number prediction in FVEG_13587-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	11	257	6.3e-52	0.9325842696629213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.64e-27	14	260	18	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
395531	Lipase_GDSL	1.40e-09	67	237	50	216	GDSL-like Lipase/Acylhydrolase.
238875	SGNH_plant_lipase_like	8.20e-09	55	238	80	265	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73030.1|CE16	6.71e-182	1	264	95	358
QGI85829.1|CE16	8.33e-182	1	264	101	364
QGI68638.1|CE16	8.33e-182	1	264	101	364
QGI99528.1|CE16	8.33e-182	1	264	101	364
UPL04243.1|CE16	3.49e-77	11	264	76	326

PDB Hits     

FVEG_13587-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	3.63e-50	15	263	53	297	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	3.63e-50	15	263	53	297	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000003

TMHMM  Annotations     

There is no transmembrane helices in FVEG_13587-t26_1-p1.