CAZyme Information: FVEG_13585-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_13585-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256		28483.48	9.3375

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000585.1:2853300-2854070(+)

Full Sequence      

MLFRPLTSRSCRLLITGQCASRIHVTSTTSNKVNQASVTLYSTQTTPPNVALRLMPLGGS
VTYGVGSSDGNGYRKLLRDLLLADGYEVCMVGSRKAGSMHNNENEGWRGYRLDQIEGKAR
RSVATVKPNLFTINAGSNDCIQSHKLDAFGRRMDDLLEYLWEISPLSTVILSTLLVNEDK
QVNSRVQEINGRLRNLVVLKQAEQKKIILADMYCTKGSEIDDLLDGTHPNDDGYSKMAHV
WFNSIAKARANGFFHK

Enzyme Prediction     

No EC number prediction in FVEG_13585-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	52	245	3.2e-55	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.82e-37	52	245	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	3.00e-17	57	234	2	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	8.88e-14	57	238	4	181	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	4.36e-11	54	241	1	224	GDSL-like Lipase/Acylhydrolase.
239947	SGNH_hydrolase_YpmR_like	4.37e-09	57	238	5	198	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI68641.1|CE3	2.59e-145	4	256	4	256
QKD62224.1|CE3	2.81e-118	55	256	1	202
QYT04935.1|CE3	1.42e-80	52	253	52	253
CAP79838.1|CE0	1.45e-79	51	253	103	305
BCS23966.1|CE3	5.73e-78	36	252	48	266

PDB Hits     

FVEG_13585-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	9.00e-15	52	245	44	260	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000006

TMHMM  Annotations     

There is no transmembrane helices in FVEG_13585-t26_1-p1.