CAZyme Information: FVEG_13459-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_13459-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708	CM000585.1|CGC12	79954.57	7.2105

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000585.1:2536651-2538935(+)

Full Sequence      

MDSLTTNPPRSILIGKQKDQVHANVRIVHGKTRSNGSDVSDTEYPVVPIPAYLTDEASSN
DSYRASQPSSLRSSTTDTQRTSVISRPGSKGADLIAPIPRLPVSISNNTSVGSRSDAGHS
STPSVDDEITPVPQPSAERDAASQFKSDGAEQAKPKLTLRKVTTQKYVLTAGLIAVNFMF
IFASWYWPRYYYIYLPFISFPLVLNCIMIASIAVFTLIHWVSPEEQNKPSSPENMVYVIP
CYNETLEECTRSLDSLVNQTGLENHKKGIMVICDGRVRGPGMTKTTGDYLNQDIFLHQTQ
RKRIRGAYTAWDGQQMDIEISKGFYKGLPFYCIVKDQNQGKRDSLIVIRSFLYKFNTRAQ
NPESIFSREFLDSMTSWLENEVKMDNVDHLIGMDADTVFEDKCVTELLKESYYPNTVGVC
GYVAVDFKDGNWNLWSIYQSAEYTIAQGLRRLHQSVATKKVSCLPGCCQLLKICEETCGD
LVLIDLFGYFPKHMDGMLKRIRATASEDRNHICQLLVTFPHAQTRQALHARAYTDVPHSW
NVFLSQRRRWTLGATSNDLLLFCAWNTQWWERIVAFSNVLTWSLNVFVIASIGCMIVAFM
SQPWWLIMCFAGVMIIPLLYYVIMATWLPRNLVERAQFILGLLVFVFLGPFLNIAVMLYA
VVNMDNFGWGKTRKVVTDDSEEERSSQKEGIVSDSSSTEPKEKIATAV

Enzyme Prediction     

No EC number prediction in FVEG_13459-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	335	692	4.2e-31	0.6774193548387096

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	6.73e-34	207	676	4	496	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	6.58e-21	239	551	3	238	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	2.29e-13	191	667	5	397	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	9.36e-10	238	470	2	160	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
340913	MFS_YcxA_like	0.005	579	669	70	157	MFS-type transporter YcxA and similar proteins of the Major Facilitator Superfamily of transporters. This group is composed of uncharacterized bacterial MFS-type transporters including Bacillus subtilis YcxA and YbfB. YcxA has been shown to facilitate the export of surfactin in B. subtilis. The YcxA-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62066.1|GT2	0.0	1	708	1	730
QGI85706.1|GT2	0.0	1	708	1	730
QGI68508.1|GT2	0.0	1	708	1	730
QGI99400.1|GT2	0.0	1	708	1	730
CCT72888.1|GT2	0.0	1	708	1	730

PDB Hits     

FVEG_13459-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13395|CHS6_USTMA	1.12e-27	222	676	401	860	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|P30573|CHS3_CANAX	1.11e-23	236	679	665	1134	Chitin synthase 3 OS=Candida albicans OX=5476 GN=CHS3 PE=3 SV=1
sp|J9VF17|CHS4_CRYNH	4.57e-23	239	676	512	959	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|J9VNT4|CHS5_CRYNH	7.12e-23	202	678	1222	1708	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|P29465|CHS3_YEAST	7.58e-23	239	675	658	1120	Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHS3 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

Start	End
168	187
197	219
578	600
604	626
639	661