CAZyme Information: FVEG_13457-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_13457-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	CM000585.1|CGC3	43796.88	4.9762

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000585.1:2529841-2530989(-)

Full Sequence      

MAVTRAKDNATETKPEDWEAGQCDCYLTDGIEPEYYTHHRFWDFRNLGDYAGIPDTIAGE
NASAEADVTSKYFKKKEWKDFWAIQSWSNRRSHDTLAYGARFPMVNSANNIYIRINPDKN
PASETYLSMRTSRQQDFQVASEFDSIDRFQFLSIRFLGRVRGAPGACMAMFTYVPADEIK
NVQEADMEILTREDYDRVHYTNHPGYSIEGEVYPKATRNTTLPDNLKWNEWVEHRMDWTP
SQSIWYANGKQVANISFQVPRDPSLMIFNTWGDGGVWTQNMTTGEEAYMEMQWLQLLYNT
SDTSDKRKRDDKGPKGRFLRKRGDENVCRMVCSIDDEDGAGVVTWLLGNSTASSLLAERS
VGASFGGLISWVLGLVVLARWI

Enzyme Prediction     

No EC number prediction in FVEG_13457-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	80	295	1.2e-89	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	8.04e-50	76	293	7	206	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI99398.1|GH16_22	2.29e-278	1	382	13	393
CCT72886.1|GH16_22	2.29e-278	1	382	13	393
QGI68506.1|GH16_22	2.29e-278	1	382	13	393
QGI85704.1|GH16_22	2.29e-278	1	382	13	393
QKD62064.1|GH16_22	2.18e-274	1	382	13	394

PDB Hits     

FVEG_13457-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

FVEG_13457-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999964	0.000073

TMHMM  Annotations     

There is no transmembrane helices in FVEG_13457-t26_1-p1.