CAZyme Information: FVEG_12913-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_12913-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500	CM000588.1|CGC13	56436.78	6.0971

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000588.1:256248-257801(+)

Full Sequence      

MLSTSAAMWLLAVLCSEIPKALAQDAEGWYKTHPNMARIKHVNQDTHQIVDEYGRTRFFH
GTNVVMKEEPWYRPFEWTPGVSSFGERDVQNMHDLGLNIVRLGHSWAGAEPVRGEYNQTF
LDIMKKQTKLAEDHGIYVLVDVHQDVLARQLCGHGVPDWFVKKDWITGFRRFPFPQKLKP
FTTDTDGFPSPQSQCNTIDWSLSYLSVAVGNAFGRLYNNFDGLGDAFAAYWKKLASEYVD
TTNIVGYNLLNEPWVGDTYADPTLLVPGVADRKNMEGLWNRATKQIRTVDNDTFIWFEGA
TFDVLSGFNNVPLGDGSKTVHSFHYYNPPQLGPLKDTLYNRQKDNVRLKTAGVLTELTFW
MGDDKQMAGLAEAMAATDANMVSWIGWAYENLYDGISGKPYPELEKHYSRAYPAAIAGTP
ISFGFDETSGIFKLNFTSDPNIDAPTEIILPTSTFPNGYEVRVLPGGSLLQYKLDDRTLA
LFTSRALKQKTEISVRISRK

Enzyme Prediction     

No EC number prediction in FVEG_12913-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	58	389	1.8e-145	0.9969135802469136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	6.59e-20	410	495	1	86	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
395098	Cellulase	1.96e-09	50	389	1	268	Cellulase (glycosyl hydrolase family 5).
396834	Glyco_hydro_42	3.10e-08	72	155	2	96	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
224786	GanA	1.03e-04	72	165	22	103	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGJ01570.1|GH5_27	0.0	1	500	1	500
QGI70680.1|GH5_27	0.0	1	500	1	500
QKD62446.1|GH5_27	0.0	36	500	1	465
CCT75388.1|GH5_27	0.0	36	500	1	465
QGI88025.1|GH5_27	0.0	1	500	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CCU_A	7.64e-27	34	463	36	446	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5CCU_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
5J14_A	1.39e-26	34	463	36	446	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J14_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_A Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
2OSW_A	3.23e-25	51	483	39	466	Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OSW_B Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OYK_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYK_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYL_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYL_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYM_A Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.],2OYM_B Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.]
2OSX_A	5.87e-25	51	483	39	466	Chain A, Endoglycoceramidase II [Rhodococcus sp.]
6JYZ_A	1.30e-14	49	312	32	277	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9GV16|EGCSE_CYANO	2.68e-92	42	494	34	497	Endoglycoceramidase OS=Cyanea nozakii OX=135523 PE=1 SV=1
sp|Q6L6S1|EGCSE_HYDVU	2.41e-82	42	465	25	453	Endoglycoceramidase OS=Hydra vulgaris OX=6087 PE=1 SV=1
sp|A0A3S5YBC7|EGCSE_RHOH1	6.72e-26	39	463	33	438	Endoglycoceramidase I OS=Rhodococcus hoagii (strain 103S) OX=685727 GN=REQ_38260 PE=1 SV=1
sp|H1AE12|EGCR1_CRYNH	5.75e-06	96	256	81	262	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999730	CS pos: 23-24. Pr: 0.9728

TMHMM  Annotations     

There is no transmembrane helices in FVEG_12913-t26_1-p1.