CAZyme Information: FVEG_12644-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_12644-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		35972.64	4.2645

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000580.1:473220-474558(-)

Full Sequence      

MELSVVYFLCILSLASASFNFGFSSSPVLLPRAKNPTSKDGNCGSNSETNATCLTSTFGN
CCSEKGFCGKTSAYCSEGCQEAFGSCSSSDDGQLVSTSGSCGATSTSNITCEGSSYGDCC
SEKGYCGKNATYCGAGCQSMFGSCSSSDDSSTTTATSDKTSTSTAAASTSLGAISIDGNC
GSNSDTNATCLDSEFGDCCSAKGYCGKTSDYCSTGCQSDFGSCDSTSDSTTSSASESASS
STSSSESSSSTSSTTSSTAGLSTGAKAGIAVGSVIGGLGALGLVGFLVLRGKKRKSSQQQ
LEDNDVGKPDEETRYELHDERTHEMHAQNLVELPADYGRVDDRAAAGYDGAYRGH

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	8.71e-09	184	223	4	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	2.42e-07	47	86	4	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	2.25e-06	105	142	4	41	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	8.73e-05	179	218	1	36	Chitin recognition protein.
395135	Chitin_bind_1	6.81e-04	42	80	1	35	Chitin recognition protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI78660.1|CBM18	4.43e-150	1	355	1	352
QGI61474.1|CBM18	4.43e-150	1	355	1	352
CCT65321.1|CBM18	4.43e-150	1	355	1	352
QGI92372.1|CBM18	4.43e-150	1	355	1	352
QKD51953.1|CBM18	5.73e-141	1	355	1	352

PDB Hits     

FVEG_12644-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

FVEG_12644-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000289	0.999678	CS pos: 17-18. Pr: 0.9658

TMHMM  Annotations     

Start	End
267	289