CAZyme Information: FVEG_12612-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_12612-t26_1-p1
• CAZy Family: GH93
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
656	CM000580.1|CGC4	72944.84	6.3288

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000580.1:542499-544570(-)

Full Sequence      

MRYINITAHDRSWCFAIQQSLRLHLPTSQILQTPPSTSLTRLISFNSFTLTTPSTHQVQL
SKMAFVANGNEYDFIIVGGGTAGNAVAGRLAENPNTRILIIEAGIPNPHQIPEITTPSKA
FNLRGSKHDWAYKSTMIKRDDYERIEKPNTRGKVLGGSSCANYFTWIPGSKPTFDDWEAF
GGEDWNWDGCVEYLRKCATYHDEEGLYPAELGKIGTGGPIQIAHADLVPEMQPWRDALTE
AWVSKGEVLTENIYDGEMRGLTHCVDTIHGGQRQGSFLYLKNKPNVNILYGVQSKELIID
PRTNTCLGVTVINPDTKGELSVFASKEVILSQGVFETPKLLMLSGVGPAQELKKNDINVK
LDSPHVGQHLLDHPIVPFVLQVKDGFGLEDYILRDGAANSAAVAQYKRDKTGPVSSGLLE
LVGFPRIDERLEQHQSYREAKAANGGLDPFGPKGQPHFELDFVGMFSTAFQWHYPVPEKG
NYMTVIVDLLRPLSEGQVTLNSNDPLVQPNINLNFFGNDLDILAMREGVRWTYDVLTTGK
GFKDIVLGEYPWRMPLESDEEMKRAVLDRSQTGFHPCGTARLSKNIQQGVVDSRLRVHGI
KNLRIADASVIPVIPDCRIQNSVYMIGEKGADMIKADHPEIFGQEATRANPFTSRL

Enzyme Prediction     

No EC number prediction in FVEG_12612-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	71	637	3.4e-147	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.24e-86	70	639	4	536	choline dehydrogenase; Validated
225186	BetA	1.36e-86	69	641	5	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	8.92e-43	492	629	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.60e-22	151	375	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	9.72e-20	23	627	12	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD51991.1|AA3_2	0.0	63	656	1	595
CCT65282.1|AA3_2	0.0	63	656	1	594
QGI61436.1|AA3_2	0.0	63	642	1	580
QGI78622.1|AA3_2	0.0	63	642	1	580
QGI92334.1|AA3_2	0.0	63	642	1	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.17e-300	68	642	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	3.34e-300	68	642	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	9.55e-300	68	642	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	6.17e-72	71	637	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.31e-71	71	637	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0R4L2|PDH3_LEUMG	4.56e-60	71	634	40	595	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|B7N8L3|BETA_ECOLU	9.79e-60	71	635	2	532	Oxygen-dependent choline dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=betA PE=3 SV=1
sp|Q8UH55|BETA_AGRFC	3.13e-59	73	651	4	542	Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=betA PE=3 SV=2
sp|Q0TKW1|BETA_ECOL5	4.99e-59	71	635	2	532	Oxygen-dependent choline dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=betA PE=3 SV=2
sp|A9AMZ9|BETA_BURM1	8.43e-59	71	639	5	537	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FVEG_12612-t26_1-p1.