CAZyme Information: FVEG_12594-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_12594-t26_1-p1
• CAZy Family: GH93
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	CM000580.1|CGC15	43224.82	7.3148

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000580.1:603701-604876(+)

Full Sequence      

MKTSLAFASVTALSRSLAIAAPPSNYLNWKTFKANGVNLGGWLHQEAIIDPTWWNQYAPG
MPDEWDFCAKLKSQCGPVLEQRYGSYITAKDIDTMAAAGINVIRVPTGYNAWVTVPGSQL
YSGNQARYLRAISDYAIKKHGIYVILDIHSLPGGLNGMGLGEKEGNYGWFQNQTALEYSY
KAVDAALKFIQESDVPQGFTLAPINEPVDNRDITKFGTPDALSDQGAAWVLQYFQGVISR
VEKVNPKIPIMLQGGFRPVDYWAKHFAASTNIVFDVHNYYFAGRPTTSQNLAELICSDAK
DIVSTASPKFPVFVGEWSIQAATNNTFASRARNLNTGLKAWTAYTRGSAYWTWKFFGNVP
VDGEGTQGDYWNYSDFVKMGIISPSSEVTCK

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	83	364	5.7e-139	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.18e-17	22	387	6	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	9.46e-12	83	357	20	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT65263.1|GH5_23	1.39e-274	1	391	1	391
QKD62241.1|GH5_23	1.89e-272	1	391	1	391
QGI78607.1|GH5_23	8.19e-268	1	389	1	389
QGI61425.1|GH5_23	8.19e-268	1	389	1	389
QGI92323.1|GH5_23	8.19e-268	1	389	1	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	2.46e-150	26	382	11	364	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	5.94e-148	19	383	6	370	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
1EQP_A	1.96e-15	36	295	11	265	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	4.90e-15	36	295	17	271	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	6.37e-15	36	295	11	265	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	4.51e-34	4	318	14	310	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	4.08e-27	36	318	44	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	5.53e-27	27	318	35	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|Q4WK60|EXGA_ASPFU	5.60e-27	36	318	44	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|A1D4Q5|EXGA_NEOFI	1.05e-26	36	318	44	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.292859	0.707118	CS pos: 20-21. Pr: 0.6117

TMHMM  Annotations     

There is no transmembrane helices in FVEG_12594-t26_1-p1.