CAZyme Information: FVEG_12482-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_12482-t26_1-p1
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		45475.56	4.4598

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000581.1:4127016-4128489(+)

Full Sequence      

MTRLSQLLLAAGATLVGLTSAQCSLTPTASIATADGVEFKLLRTGLQRPRHLVVDTEGNL
LIAEAGSKGVRRVVLDDGKDLDVCIDSDKALISNANLNHGIALTADGKTILVSTPSEVYA
YDYDASKGTVGSRRTVITGMSATSTHSTRTLTIPLAANPNLLLVAGGSDGNLDVETVNKD
VVRSQVRVFKIDELLAADAPLVYGEAEVLGWGLRNSVGWAEDPSTGNVWSVENSVDNLYR
GDVDVHNTNPGEELNFHGLPNDTSSARYGANYGYPGCFSIYDTSNIKDYPSGAEVGKQFA
GTPDGETDLGFTDEECQEKQAPRITFGSHLAPLDIKFLDGSAAYIAFHGSWNRNPGDGYR
LSKVDFANGEPVPESDDPKAEVPLMWNTDNSKCPSGCFRPAGLAFDKSGRLFLTSDSTGE
LYVLTGV

Enzyme Prediction     

No EC number prediction in FVEG_12482-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	26	424	2.2e-147	0.9825436408977556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	2.05e-20	7	351	8	342	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].
400653	SGL	1.24e-04	88	139	131	179	SMP-30/Gluconolaconase/LRE-like region. This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30), gluconolactonase and luciferin-regenerating enzyme (LRE). SMP-30 is known to hydrolyze diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 and LRE.
400382	GSDH	6.55e-04	196	342	157	262	Glucose / Sorbosone dehydrogenase. Members of this family are glucose/sorbosone dehydrogenases that possess a beta-propeller fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61370.1|AA12	4.04e-299	1	427	1	427
CEF78754.1|AA12	5.49e-281	1	427	1	427
CZS82044.1|AA12	5.49e-281	1	427	1	427
QPC59943.1|AA12	2.20e-276	1	427	1	429
QPC71254.1|AA12	1.67e-275	1	427	1	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1Q_A	9.77e-105	34	424	14	400	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	1.01e-104	34	424	15	401	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	1.04e-104	34	424	16	402	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	2.16e-66	27	424	11	408	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q44091|SNDH_GLULI	5.04e-17	27	426	56	443	L-sorbosone dehydrogenase OS=Gluconacetobacter liquefaciens OX=89584 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999780	CS pos: 22-23. Pr: 0.9361

TMHMM  Annotations     

There is no transmembrane helices in FVEG_12482-t26_1-p1.