CAZyme Information: FVEG_12440-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_12440-t26_1-p1
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
941	CM000581.1|CGC22	104348.22	6.3788

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000581.1:4013165-4016591(-)

Full Sequence      

MTSEKSPMASEKSASRFIETGVLQPPSPTTDAATLKRLEAGDHGAVKTTEYFTRKSPPSR
SAHSSYSGTPVAMQIPDAAAADLPVVARYIARRATLLGWFDEPAATAITSGWSSTCIALK
KLDGTYIYNPDDPSPDLAAAVNRLNESAIVSMASEVTNSVLDSIKPDQASLVNEDTGARI
PIIPSLADVHETLVNLTSSCIVVQERCVLIWAHEARTVLTVAHNVEKQMLGFIVGPNMPR
GLHAQTEDQSVNGMPTPVRGAIDERNEVYQAAIKVEEGGEGDEDVEGQELKRPTLLVHSF
RIGIVILLVILTQSVGVSRLIRQWSWDGDFTRFALVAVTPPLCVLSLFFFIVVVSSVFQL
LLPAGICLRNSKFHSAIKPNPKRYRDYQLPHITVQMPVYKEGLRGVIVPTMVSVMAAIQH
YENQGGTASVYINDDGMQCIQPELAAARKQYYRENGIGYCARLPNKKSPNPQGRANELGF
VRKGKFKKASNMNYCLAFSNRVEDEMLRLTELECESRGCSYEDLSAEDDDRLYDQALQNM
VDADEGKTWAEGNIRMGEIILLIDCDTRVPIDCLLYGALEMYESPEVAILQHGSGVMQVA
HNIFENGITYFTDIVYTAIKYGVGTGDVAPFVGHNAFLRWKAIQSVAFVDPSDKVTKWWS
DSHVSEDFDISLRVQMAGMVCRLATYHNGGFQEGVSLTVYDELNRWEKYAYGCNELVFHP
FYKWPYKGPVTRLFLRFLWSNMPVTSKVSILAYIFTYYAIAAGMLLTLVNYVLVGLFFQD
LDQFYTPSWGIWVSLLVVFNGVASIATSMTRHRLKEKSFWVAILEACKWLPFLLLFFGGI
SINCAKALLCHAFSVNIEWASTSKELGPTGIYIGLNKMMHRFKWTFLICIVLAAGMMYMA
FGAPWGWTIAPGKFSAGTYAIVPLAVQVSCAFALPLFLGLT

Enzyme Prediction     

No EC number prediction in FVEG_12440-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	559	772	3.5e-52	0.9847715736040609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	4.99e-52	559	766	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.65e-09	557	859	138	419	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.73e-05	557	667	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224137	GT2	1.13e-04	549	754	69	281	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61408.1|GT0	0.0	1	941	1	968
QPC62761.1|GT0	0.0	8	941	1	973
QPC80132.1|GT0	0.0	8	941	1	973
SCB65002.1|GT0	0.0	8	941	1	973
CEI70391.1|GT0	0.0	8	941	1	975

PDB Hits     

FVEG_12440-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

FVEG_12440-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

Start	End
299	321
333	355
754	776
788	810
820	842
886	908
918	940