CAZyme Information: FVEG_12372-t26_2-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_12372-t26_2-p1
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528		56914.86	9.4934

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000581.1:3820559-3822145(-)

Full Sequence      

MKGSTLGTKYDWNFTTVPQASANNRVWPINRGKVLGGSSALNLMTYDRAAVAEYDAWEAL
GNPGWNWKTMIKAMMKSETFTGKNTATYGSKGVGDSGPVKAVVNRIIPKHQESWIPTLNK
LGVRKNLESLGGNPLGVMYQPSSIDPSNYNRSYSANAYTEISGSNLEILADTIVAKINVS
GPAAKKKAIATGVTLQDGTYVKARREVILSAGSIQSPGLLEQSGIGSKSVLSAAGIKQII
DLPGVGENLQDHLRVMTSYQLKPEFLSFDALRSNATFAAEQLALWNAGKRSLYDYTGSAY
TFSTWKQALGNDANLVSLAKEAAGKDTSKVDKKKLDFLKDSSVPQVEVIFSDGYTGVKGY
PAATSPLFGKGFVTLIGVVMHPLSRGSVHINPSDPAGKPTINPNYLSNSHDVEAVLQTVK
YNRKIANTEPMRSIWVDEYEPGLDVKTDEQLKDYVLRTTLSIFHPSGTCAMLPKADGGVV
DAKLKVYGTENLRVVDASVIPLLISAHIQTAVYGIAEIAAELIIKDAK

Enzyme Prediction     

No EC number prediction in FVEG_12372-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	526	3.8e-160	0.9102112676056338

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.32e-81	7	528	59	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.94e-79	7	523	60	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	5.13e-44	382	517	1	141	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	6.56e-27	20	253	12	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.61e-09	165	499	234	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61481.1|AA3_2	0.0	1	528	71	598
CEI62186.1|AA3_2	0.0	1	528	71	598
QPC59688.1|AA3_2	0.0	1	528	79	606
CZS81759.1|AA3_2	0.0	1	528	71	598
QPC70868.1|AA3_2	0.0	1	528	71	598

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	3.90e-70	3	528	54	569	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	2.81e-64	10	526	58	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	1.02e-60	12	526	95	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6XUT_A	1.40e-59	29	523	84	587	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5OC1_A	2.31e-58	10	526	58	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	9.10e-86	4	524	99	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	9.10e-86	4	524	99	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	7.38e-71	2	526	93	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	3.28e-64	10	526	70	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A1CFL2|PATE_ASPCL	3.79e-62	11	517	116	618	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FVEG_12372-t26_2-p1.