CAZyme Information: FVEG_12338-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_12338-t26_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431	CM000581.1|CGC31	48478.64	6.1485

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000581.1:3733921-3735643(-)

Full Sequence      

MRGSQTIFVLGAPLLTTVNAESLPAGVARDISEFRDKHPYAPPKHKHREIVRIRASKNDT
DDVSDEFKMGVRKANGGGTLHLTKGKTYIIGKALDLTGLEDIHIHLEGEIRFTDDVEYWQ
ENALYHPFQKSIMFGSGEEKTLKFTAMVQRWWNEFESGTGSILIPNNKYYRPILFYAENT
TNLDVSGIHSKTRLAGTTSSIIPKNTDFMNTMNTSTFRIERTWVNIDDVCFSPKPNSSDL
YVNTMYCNGTHGQSMGSLGQYRGEVSNVYDVHIENVWMMNGDYSAARIKVWAGEETGTGF
VNNVTFKNFWVARMDYGIFLDSCYFNISSEECNAHPSDMKSHQHKFRELYWDAVCANITV
KDFDVRTPCGKEPVIICDGMDGDIGVDCVPYDSDEAKAALKAKCTTPMAAIDTDPWGNGL
IEKKKGAFHPQ

Enzyme Prediction     

EC	3.2.1.67:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	172	378	1.5e-24	0.5907692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	2.53e-16	91	365	14	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	7.11e-12	198	335	219	344	Probable polygalacturonase
215540	PLN03010	1.62e-11	59	383	59	392	polygalacturonase
178580	PLN03003	7.06e-09	205	337	187	314	Probable polygalacturonase At3g15720
215120	PLN02188	1.64e-08	205	372	204	381	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWW14915.1|GH28	1.06e-259	1	431	1	477
QKD61505.1|GH28	1.06e-259	1	431	1	477
QNQ74175.1|GH28	1.06e-259	1	431	1	477
QNQ74174.1|GH28	2.04e-257	1	431	1	477
UPK95511.1|GH28	7.53e-236	1	430	1	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	3.83e-32	58	388	27	382	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	9.04e-06	205	326	165	280	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DAX2|PGXB_NEOFI	6.77e-101	44	388	46	431	Probable exopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxB PE=3 SV=1
sp|Q0C7H7|PGXB_ASPTN	6.25e-100	44	388	45	430	Probable exopolygalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgxB PE=3 SV=1
sp|Q873X6|PGXB_EMENI	2.05e-99	43	388	50	436	Probable exopolygalacturonase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pgxB PE=2 SV=1
sp|Q2TW03|PGXB_ASPOR	7.03e-96	44	388	45	430	Probable exopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgxB PE=3 SV=2
sp|B8NX60|PGXB_ASPFN	9.93e-96	44	388	45	430	Probable exopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000418	0.999560	CS pos: 20-21. Pr: 0.9752

TMHMM  Annotations     

There is no transmembrane helices in FVEG_12338-t26_1-p1.