CAZyme Information: FVEG_12241-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_12241-t26_1-p1
• CAZy Family: GH75
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229	CM000581.1|CGC20	24702.80	10.0470

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000581.1:3492360-3493049(+)

Full Sequence      

MATPILPAVALPNIRVLPLGDSITKGTGSTGLVGYRLPLRQKILKQGVKVNMVGTLKNGN
MVDGHHEGHSGKMLADINGYWQKPIQARPNVVLIHAGTNNMDQGKDLDIAASILADIVDG
IFKVAPDVTICLAPVIWANDKKMQANTDKFNPQVRSLISARQKKGKHILEVPIDIKKEDL
GDSKHPNDGGYEKMANAWLKAILEADKKGWLKMPVKMSPEDAPGTGLGA

Enzyme Prediction     

No EC number prediction in FVEG_12241-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	14	202	2e-50	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	6.32e-50	14	202	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.50e-14	19	193	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.13e-11	16	201	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
239947	SGNH_hydrolase_YpmR_like	1.82e-08	19	201	5	204	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
238865	sialate_O-acetylesterase_like1	1.15e-07	14	202	1	187	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC62878.1|CE3	6.13e-138	8	229	20	241
CEI70576.1|CE3	2.28e-136	1	229	16	244
QKD61617.1|CE3	4.08e-131	1	208	551	758
QKD52243.1|CE3	3.00e-88	8	228	24	246
CCT63634.1|CE3	3.16e-88	8	228	24	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	1.03e-17	10	204	2	197	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	1.57e-12	10	212	40	265	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FVEG_12241-t26_1-p1.