CAZyme Information: FVEG_12213-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_12213-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511		56882.75	8.3184

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000581.1:3422347-3424027(-)

Full Sequence      

MFARVLLFAALLITPLAYFLSLQTSTDYTRYVKGRKKTVLFLTNSEPGLSNVHLATASAI
LENYPDIEVHFASFPAIEPKLERASSFAMIKSPHAKSIAFHGLAGPTFVQAIAREGRSFI
SPPGWRGIATLAEHIQLWISPWTFEDHVHLYKELITIIDEVDPAVIVLDSWFRPAIDATR
KRNRQHAFITPNTLVDHFLGIQPFWTRLWKYPAPSSGFPFPVPWLKLPENIYMNIRYIYS
AMFTPDILEKKGRLQQIGLREPINLFGIHRPGVQWITQNTQGAMIPVEVLPPNVTCAGPI
ILPGPPADQQDPGTAAWLKKAPTVLINLGSNLAYDESRAGVMATSIAALLSTTGYQVLWK
FNKLGDFSDEFLVNLKPYLDNERLKMPSWLMADPASLLETGNIVTSVHHGGSNCYHEALA
AGVTQVVLPLWADLYNYAALAETRGIGVWGCKDSTPNWTSECLLDAFMKGIDGCGESFLQ
RRAKWLGDRIKAGKKGRDVAADEIAKLAYVR

Enzyme Prediction     

No EC number prediction in FVEG_12213-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.26e-14	39	507	3	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.95e-05	36	449	1	347	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	0.001	343	473	294	408	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	0.004	265	448	231	410	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61647.1|GT1	0.0	1	511	1	511
CEI41903.1|GT1	6.09e-201	7	509	5	511
UPK94308.1|GT1	1.27e-198	1	510	1	512
CZS74954.1|GT1	1.07e-196	6	509	4	511
CEF84524.1|GT1	1.07e-196	6	509	4	511

PDB Hits     

FVEG_12213-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1B4XBH6|SDNJ_SORAA	1.07e-66	34	465	3	443	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	1.31e-65	34	496	3	463	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|Q9GLD9|UDB33_MACMU	2.21e-06	275	448	256	413	UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta OX=9544 GN=UGT2B33 PE=1 SV=1
sp|Q9TSL6|UDB23_MACFA	2.21e-06	275	448	256	413	UDP-glucuronosyltransferase 2B23 OS=Macaca fascicularis OX=9541 GN=UGT2B23 PE=1 SV=1
sp|Q8WN97|UDB30_MACFA	2.92e-06	212	448	195	413	UDP-glucuronosyltransferase 2B30 OS=Macaca fascicularis OX=9541 GN=UGT2B30 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.608501	0.391492

TMHMM  Annotations     

Start	End
5	22