CAZyme Information: FVEG_11869-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_11869-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260		28078.64	4.5029

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000581.1:3151018-3151847(+)

Full Sequence      

MIPSGDSYSTVGFWPGGDLPSAGSPLGNPALPGQTTANGLNWVGQLTSVLNTSTILTYDF
AVTGATVDKEIVSTYAQYCVDDQVAQYKEYVADKISSADTLVAVWIGINDLGEPFWKKSA
APIEKTMDRYFELLKTLPEAGLKKFALLTVPPFADQIPAMIGQSESDLKTLRADIIAYNK
ALTERAATFSNSSSDIEVTVFDTKPTFDSAVKNFKEYGAKDAACYGGNDCLWTDTYHAGV
AIHKALAKNFAESISKTFTF

Enzyme Prediction     

No EC number prediction in FVEG_11869-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	3	250	4.9e-64	0.9850187265917603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.28e-55	5	252	6	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
395531	Lipase_GDSL	7.77e-08	33	250	13	224	GDSL-like Lipase/Acylhydrolase.
238875	SGNH_plant_lipase_like	5.63e-07	60	232	80	279	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	1.05e-04	5	254	8	280	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
238872	SGNH_hydrolase_like_2	3.14e-04	92	253	55	191	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT67752.1|CE16	8.52e-172	1	260	33	292
QGI63796.1|CE16	2.37e-163	1	256	33	288
QGI94678.1|CE16	3.36e-163	1	256	33	288
QGI81068.1|CE16	2.00e-162	1	256	33	288
UQC87704.1|CE16	6.46e-126	1	260	36	316

PDB Hits     

FVEG_11869-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	2.07e-54	1	258	34	301	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	2.07e-54	1	258	34	301	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999300	0.000740

TMHMM  Annotations     

There is no transmembrane helices in FVEG_11869-t26_1-p1.