CAZyme Information: FVEG_11140-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_11140-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
650	CM000586.1|CGC8	72551.60	6.2412

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000586.1:516112-518064(-)

Full Sequence      

MSSGKTIQPIAYWLRHRLMFSRSWAIEDTEEDDYHRAYKETTPTPYCFPTISTTTLNFTS
RPILLLSYFTMAVKNGAYFDFIIVGGGTAGNIVAARLAENPNARILVVEAGIGTSKDNEE
IRTPGLAMDIRGSKYDWAYKTTMIKRDDYERIEKPNTRGKALGGSSSLNYFSWVPGSKGT
FDMWEEYGGKEWTWEPLVPYLRKSVTYHDDAGLYPPELKKIGAGGPIPIAHAELMPEMKP
FRDLLTKAWKSTGEPVSENIFDGTMRGLVHSVNTIYKGRRSGSFLAVADKPNITIFPEVH
SKRLIIDQADRTAKGVTVITASGEELDLYATREVIVSQGVFETPKLLMLSGIGPKAELAK
HNIPLLVDSPHVGQHLLDHPGVPFVLKIKDSYSMDSHVLRKGALQDKVMSAYANGHAGPM
GSPFLEMIGFPRIDSYLEKSPEYRAAKAANDGLDPFCPYGQPHFELDFIPLFGSAFQWHF
PHPNKGSYMTVMVDLVRPVSEGGEVTLNSADPLQQANINLNYFNNDLDIIAMREGIRYSY
DVLKNGEGFKDIVEDEYPWDMPLDDDEAMKRTVLDRSQTSFHPCGTARLAKSVEQGVVSP
SLQVYGIKNLRVIDASVIPVIPDCRIQNSVYMVAEKGADAIKRDHTDLYH

Enzyme Prediction     

No EC number prediction in FVEG_11140-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	79	644	1.4e-147	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	9.70e-84	79	645	8	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.88e-79	79	642	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.23e-36	498	636	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.06e-22	79	633	56	568	Protein HOTHEAD
366272	GMC_oxred_N	1.21e-17	158	380	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59313.1|AA3_2	0.0	71	650	1	580
QGI68848.1|AA3_2	0.0	71	649	1	579
QGI99737.1|AA3_2	0.0	71	649	1	579
CCT73322.1|AA3_2	0.0	71	649	1	579
QGI86218.1|AA3_2	0.0	71	649	1	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.01e-316	75	649	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.89e-316	75	649	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	8.26e-316	75	649	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	4.16e-64	79	644	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.58e-63	77	644	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	8.12e-55	79	641	7	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	5.24e-54	77	643	39	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q0R4L2|PDH3_LEUMG	6.01e-54	79	645	41	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|A9AMZ9|BETA_BURM1	1.20e-53	79	642	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|B1Z034|BETA_BURA4	1.65e-53	79	642	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999292	0.000723

TMHMM  Annotations     

There is no transmembrane helices in FVEG_11140-t26_1-p1.