CAZyme Information: FVEG_10958-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_10958-t26_1-p1
• CAZy Family: GH45
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		59641.39	5.6427

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000588.1:711498-713262(-)

Full Sequence      

MASPTYDYIVVGGGLAGCVLSSRIREYDGAAKILLIEAGKETCGRSDVHNMQVLNLGGEL
DWQYQSEPVEALMGRRITLNSGKGLGGSSAINSGGWTRGAAADYDAWAALVGDDRYSYKG
QLPWFRKSELWFDDKNPDQHGSDGPIRVTCAKATNRVFPLAEKAAAGWEELGVSTLPDGD
QNSGNNLGRAYICEARCDGKREWSANQYSLDGVQVRVETFVNRIIIQKIDGNLKATAVEL
AGGSVVNGQNIIISAGAFRSPQILQLSGIGPKTHLQEFGIEPLVDLPEVGKNLSDHMIFF
QHWRLRDPSAGHTIGSANPLFQQPQYSQGVPFDWIVNTRIPQEGLAQAIERDEGTKPRES
EHVLLARNRTFVENIIMFAKLPFPGVPMDTEHITSALVSFLPTSTGSVSLKSGKPGEHPK
VDLNYLSTEVDKHVFREGLRQLTRFMLKSKFSDQIIGESIPEGLPVEALAVDDSDDKLDQ
RIAMTGGTSWHPSGTCSMGKVVDTEFRVAGVKGLRVVDASVFPVPLSAHLQAPLYALSEQ
AAAIITGQV

Enzyme Prediction     

No EC number prediction in FVEG_10958-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	546	6.5e-134	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.98e-93	1	547	1	533	choline dehydrogenase; Validated
225186	BetA	2.12e-82	1	545	3	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.92e-47	7	545	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.91e-36	402	541	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.33e-27	5	522	55	553	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI70777.1|AA3_2	0.0	1	549	1	549
CCT75503.1|AA3_2	0.0	1	549	1	549
QGJ01668.1|AA3_2	0.0	1	549	1	549
QGI88121.1|AA3_2	0.0	1	549	1	549
QKD62572.1|AA3_2	0.0	1	549	1	549

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YRU_AAA	1.74e-62	1	548	3	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	1.74e-62	1	548	3	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	1.74e-62	1	548	3	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	2.38e-62	1	548	19	579	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
7AV4_AAA	3.67e-62	1	548	79	639	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	4.32e-89	3	548	2	521	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q4K4K7|BETA_PSEF5	4.76e-66	6	548	5	536	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
sp|Q13NG7|BETA_PARXL	1.14e-65	1	548	1	535	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=betA PE=3 SV=1
sp|Q66D54|BETA_YERPS	9.48e-65	6	547	3	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1
sp|B2K8U4|BETA_YERPB	9.48e-65	6	547	3	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999992	0.000052

TMHMM  Annotations     

There is no transmembrane helices in FVEG_10958-t26_1-p1.