CAZyme Information: FVEG_10728-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_10728-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261	CM000588.1|CGC8	28301.78	10.2077

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000588.1:1344027-1344925(+)

Full Sequence      

MKPTQLLMALATIAYAAPTVEQTMAPTLAELDTHSQPHIKRCGKKGPPPYYGEHPYPNQT
YNQLTDGTPCRNVTLIYARGMGGKGNVGEVNGVGPIIFNRLATIIGGPENLAIAGVKYKA
NMKTVIQKGPREGGRAMTELINRAATQCPGTKIVLVGHSVGGALVHQSAENITTEVTARI
AAAVTLGYKKRDRIGKIPKSRILVVCRKGDSFCSKTVPWEPFVYGCPIWFYKIVKTHQNY
EKNANATADWIAGRLNGNVSR

Enzyme Prediction     

No EC number prediction in FVEG_10728-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	69	255	2.2e-29	0.9947089947089947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	5.96e-30	69	255	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62814.1|CE5	1.36e-98	1	255	1	258
QGI71007.1|CE5	1.03e-93	1	182	1	180
QGI88341.1|CE5	1.03e-93	1	182	1	180
CCT75754.1|CE5	1.03e-93	1	182	1	180
CEI39834.1|CE5	6.91e-58	1	255	1	251

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	7.86e-21	65	214	74	220	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
5X88_A	1.93e-15	62	255	16	198	Chain A, cutinase [Malbranchea cinnamomea]
1XZI_A	2.52e-15	60	214	19	179	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8X1P1|CUTI_BLUHO	1.02e-29	58	255	56	236	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1
sp|G4MZV6|CUTI2_MAGO7	2.83e-26	60	255	31	214	Cutinase CUT2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CUT2 PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	1.97e-20	70	214	31	172	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	2.01e-20	70	214	31	173	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|G0RH85|CUTI1_HYPJQ	3.63e-20	65	214	74	220	Cutinase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_60489 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000361	0.999617	CS pos: 16-17. Pr: 0.9684

TMHMM  Annotations     

There is no transmembrane helices in FVEG_10728-t26_1-p1.