CAZyme Information: FVEG_10595-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_10595-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594		64205.25	9.0528

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000588.1:1682085-1683927(-)

Full Sequence      

MQLCTWILSGLVTAVAATETYDYIIVGGGTAGGALATRLSLGLPKSKILLLEAGPEALDD
VRINVPGMRGSILGSSLDWNFSSIAQPGLNGRSISVNRGKVLGGSSAMNFLCYDRAASAE
YDAWSELGSPGWNWDTMINGMKKSENFTGNDGDVHGRSGPISSTYNRIVPDVLKPWQSTV
NKLGVPINDGGSLGGSPVGVMFQPTNIDVTNYTRSYSANSYLPKAGSYLKVKTNAHVAKV
LFSSKKSKGLVATGVALQDGSMIKALREVILSAGSIQSPGLLEMSGIGQTKVLAKAGVKK
LLNLPGVGENYQDHLRTSNTYILKEGYESFDQMIFKPDGALAKEQFNLWLENKVSWYDYT
SSAYAFLNWAQVSNSVQKKMKRLVKDGFSINGTVVDKKKLEYLSDPSIPQLELLLEANYV
GAQGYPGTSPNFITIFSSIMHPMSRGSVHINGQDVKGKPIIDLNYLNNEYDIQALIEGAR
FARKVAETEPLRSVWTAEFEPGLGKRTDTQLRDWVVKAVNSFYHPVGTCAMLPKKDGGVV
DSDLKVYGTENLRVVDASIIPVQLSGHIQTAVYGIAETAAQKLIAGEKQYAKGL

Enzyme Prediction     

No EC number prediction in FVEG_10595-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	20	583	1.5e-171	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.54e-84	17	586	2	533	choline dehydrogenase; Validated
225186	BetA	1.46e-79	14	583	1	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.82e-47	22	581	2	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.96e-44	442	579	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.47e-27	90	315	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI71157.1|AA3_2	0.0	1	594	1	594
CCT75908.1|AA3_2	0.0	1	594	1	594
QGI88492.1|AA3_2	0.0	1	594	1	594
QGJ02050.1|AA3_2	0.0	1	594	1	594
CEI41892.1|AA3_2	0.0	1	594	1	594

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	8.39e-75	18	580	3	561	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	1.55e-68	19	587	15	591	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
4H7U_A	7.50e-64	21	580	41	594	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZE2_A	2.40e-61	19	580	4	579	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	1.85e-60	21	587	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	1.37e-96	19	584	45	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.37e-96	19	584	45	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.02e-80	17	583	36	629	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	4.81e-75	21	580	14	605	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	4.81e-75	21	580	14	605	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.086497	0.913488	CS pos: 17-18. Pr: 0.7858

TMHMM  Annotations     

There is no transmembrane helices in FVEG_10595-t26_1-p1.