CAZyme Information: FVEG_10584-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_10584-t26_1-p1
• CAZy Family: GH39
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
668		72090.73	6.7247

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000588.1:1709400-1711507(-)

Full Sequence      

MRLSFVITCISVLADSAFALSSPKPHNPFIGKRDTAVEYDYVVVGSGAGGGPVAANLAVA
GFKVLLIDAGGDSGDDWVEKLPALHLMSTEFEDTRWNYFVNHYPDEKQQKKDSKMVYQKT
DGSYYTGLTPPTGAKPLGVLYPRAGTLGGCTRHNALITIAAHDSDWSYIASLTGDDSWNP
DNMRSYFEKIEKNMYLPSSIIGHGFSGWLGTSLTSLSLVVEDQKLLSLIISAASAMGKGL
LGFVLNTVAGLGQVLLRDLNAPGQTSKTGLYQVPLAMTDNVRGGPRDFILNTAKATNKDG
SRKYHLDIKLNTLVTKINFDKSGSKPRAVGVNYMQGASLYRADPRSGSAKSTGTGSVKAK
REVIISAGSFNTPQLLKLSGIGPRKELDSFKIPVVVDLPGVGTNMQDRYENTVIGKTDSD
FVITSKCTFLETQPDPCLEQYKKGLGPITKGVYGTNGIAIAIVLKSSVAEDEPDLLISGA
PAKFKGYFPGYAADSLADAEHWAWIILKAHSRNNAGTVTLKSTDPRDMPNINFNYFDTGV
NANGEGDKDLQATYEGFQFARRAFDDLIPLDGDFPEVWPGSQTNTEKKAKQFLKDEAWGH
HASCTAPIGADDDPMAVLDSEFKVRGTEGLRVVDASVFPKIPGFYIALPLYIVAEKASDV
IIKAARSS

Enzyme Prediction     

No EC number prediction in FVEG_10584-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	38	663	1.5e-91	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.45e-57	306	661	216	531	choline dehydrogenase; Validated
225186	BetA	6.83e-55	57	666	26	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.34e-29	510	657	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.26e-27	306	643	235	558	Protein HOTHEAD
366272	GMC_oxred_N	1.71e-14	139	410	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI88513.1|AA3	0.0	1	668	1	668
CCT75924.1|AA3	0.0	1	668	1	668
QGJ02071.1|AA3	0.0	1	668	1	668
QGI71178.1|AA3	0.0	1	668	1	668
QKD62988.1|AA3	0.0	1	668	1	673

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	1.05e-35	35	664	37	600	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3NNE_A	7.20e-29	38	667	13	531	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	7.20e-29	38	667	13	531	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
6YS2_AAA	1.62e-28	38	658	7	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	1.62e-28	36	658	5	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4K4K7|BETA_PSEF5	1.11e-40	36	659	2	531	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
sp|Q5B8A1|PKFF_EMENI	3.48e-40	39	663	41	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|C3K3D3|BETA_PSEFS	5.15e-40	38	659	4	531	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=betA PE=3 SV=1
sp|Q88CW6|BETA_PSEPK	1.26e-39	38	659	4	531	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=betA PE=3 SV=1
sp|A5WA97|BETA_PSEP1	1.26e-39	38	659	4	531	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000367	0.999598	CS pos: 19-20. Pr: 0.9774

TMHMM  Annotations     

There is no transmembrane helices in FVEG_10584-t26_1-p1.