CAZyme Information: FVEG_10419-t26_2-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_10419-t26_2-p1
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204		21469.45	3.7735

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000586.1:1465654-1466370(-)

Full Sequence      

MDIDCDGVQGSSADDGRCGSSGDTQSVTSFQDQLKSYGTDQKDLDANIHPYVVFGNVGTK
KNWPTFDAQKHGIKPLSVMAVVCGDKMFYGIWGDENGDDGDEAMVGEASVSLATACFGDD
VNGDNGHDEDDVLYIAFPGSDAVPGEDGADWDAKNFKDFEESLGGVGDKLVARIEDTDSG
ASCLWPGTWGMGLLVASAMVAMVV

Enzyme Prediction     

EC	3.2.1.132:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	1	173	1.8e-65	0.6818181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	1.84e-93	1	173	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59625.1|GH75	1.15e-148	1	204	82	285
CCT73515.1|GH75	5.24e-147	1	204	81	284
QGI69134.1|GH75	5.43e-147	1	204	82	285
QGJ00023.1|GH75	5.43e-147	1	204	82	285
QGI86500.1|GH75	5.43e-147	1	204	82	285

PDB Hits     

FVEG_10419-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	1.18e-57	1	174	79	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	1.93e-53	1	175	78	240	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	6.99e-52	1	175	79	244	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	6.99e-52	1	175	79	244	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q875I9|CSN_ASPFM	1.04e-49	1	175	75	237	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FVEG_10419-t26_2-p1.