CAZyme Information: FVEG_10182-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_10182-t26_1-p1
• CAZy Family: GH31
• CAZyme Description: endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286	CM000586.1|CGC14	31828.08	9.6101

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000586.1:2206385-2207294(-)

Full Sequence      

MFSPWILTVFTCLFAIAAAVTPPAYSGYTLVWQQGFEGQANTFPSTSTWNIIERVKNYNN
EIQAYVKSTSVLRQTGKNTLQLIPQFSSKTKKWTSGRIESTYTLTPKLGKITRVESSLRL
GGNSARSKQGIWPAFWLLGDAIRNGVEWPACGEVDIMENVNGQKIGYGAVHCDKAPGGIC
NEPNGIASNVQLPDSKYHVWRVQFDRRSSNLRSQSITWYLDGRVFHRVTGAQVNNTKVWK
SLCHSPMFVIFNVAVGGDWPGVPNSSTKDGIGNHMEVEYVAHYVSN

Enzyme Prediction     

No EC number prediction in FVEG_10182-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	32	283	2e-52	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	5.29e-127	27	284	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	1.36e-42	32	283	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	5.84e-16	41	283	5	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
225182	BglS	2.21e-12	75	270	84	252	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185689	GH16_fungal_KRE6_glucanase	2.21e-10	113	283	81	294	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI86725.1|GH16_3	1.65e-204	1	286	1	286
QGJ00255.1|GH16_3	1.65e-204	1	286	1	286
QGI69366.1|GH16_3	1.65e-204	1	286	1	286
CCT73745.1|GH16_3	1.36e-203	1	286	1	286
QKD59882.1|GH16_3	1.30e-201	1	286	1	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EO3_A	1.94e-45	23	280	5	275	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
3DGT_A	5.04e-41	18	280	1	271	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]
3ATG_A	9.86e-33	30	283	5	238	endo-1,3-beta-glucanase from Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
2HYK_A	2.22e-31	29	283	8	242	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
4CRQ_A	2.98e-26	28	283	3	230	Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23903|E13B_NIACI	3.85e-20	21	283	416	679	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
sp|Q27082|CFGA_TACTR	1.51e-14	92	283	85	252	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
sp|O33680|EXSH_RHIME	1.40e-06	129	283	331	457	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000197	0.999780	CS pos: 19-20. Pr: 0.9508

TMHMM  Annotations     

Start	End
5	27