CAZyme Information: FVEG_09872-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_09872-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
716		80293.54	6.4421

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000578.1:229750-231900(-)

Full Sequence      

MADMADKPVFISWKTTPLTINFTKNEFGAICIYEILPLSHCHQKSASHLFTSSELPLVSV
RLSSEGNTNDKTAKSLVGGYLSSRLRYKSHQQSHDGDVHRLDIHSEDERAGIAVTAHLSV
YGGVSVLRSAVTVVNESKSSDVIVTQVSSLTIGGLTTRSNEWNKDYVLRTATNSWFREAQ
WRKHSLPYLGIDKNGICELHDGHSGSQATFGLQNRGSFSTGSHLPMGILESESNSDTWAW
QIEHNGSWRWEIGDYKDSIYIATGGPTKADHDWRHTLSPGDSFTSPPVALTHVSGCFQDA
VRALNDYRRRIIRPHDDNKRLPIIFNDYMNCLMGDPDEDKIEALLDPVAQSGAEYFVMDA
GWYADDSNWWDDVGLWEPSKKRFPSGFKILMDKIKSKGLIPGLWLEPEVVGVRSVVGERL
PEDAFFRENGQRVVERGRFQLDFRHPEVRAWMTKVVDRLVVDYGVGYFKFDYNIEVIHGT
DAPGSSSAGANQLLHQRCYLDWVRSLLDKHSNLVIENCSSGAQRMDYAMLSVHSLQSTSD
QQDPILYAAIAAALPTCVLPEQSASWAYPQPEWSDELNAFTVVNSLLGRVYLSGRLDRLS
PSQMELIVEGMDAYKTIRPHLVMAHAIWPLGLPSWHDDWISLGLETSNGLYLAVWRRGGS
SSKEISLPRLAGCGKVQVNVVYPKRLPTQAIWKEGDNILELKFPETRCARVLHISS

Enzyme Prediction     

No EC number prediction in FVEG_09872-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	79	621	1.5e-98	0.7688953488372093

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269892	GH36	7.87e-86	320	616	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
307952	Melibiase	7.67e-35	282	545	1	265	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
225882	GalA	4.68e-29	78	680	77	650	Alpha-galactosidase [Carbohydrate transport and metabolism].
269893	GH27	6.31e-09	325	399	5	80	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
407116	Glyco_hydro_36N	7.08e-07	79	191	68	185	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI88848.1|GH36	0.0	4	716	1	713
QGI57937.1|GH36	0.0	4	716	1	713
QKD48422.1|GH36	0.0	4	716	1	713
CCT61505.1|GH36	0.0	4	716	1	713
QGI75155.1|GH36	0.0	4	716	1	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	6.29e-26	226	618	236	633	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	8.33e-26	226	618	236	633	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
6PHU_A	7.52e-24	97	619	143	643	SpAga wild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
6PHW_A	3.04e-23	97	619	143	643	Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PHX_A SpAga D472N structure in complex with raffinose [Streptococcus pneumoniae TIGR4],6PHY_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PI0_A AgaD472N-Linear Blood group B type 2 trisaccharide complex structure [Streptococcus pneumoniae TIGR4]
4FNQ_A	6.88e-23	272	672	279	683	Crystal structure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G1UB44|MELA_LACAC	3.24e-25	226	618	236	633	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
sp|Q5ARP5|AGALG_EMENI	7.41e-25	210	545	211	552	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1
sp|Q0CEF5|AGALG_ASPTN	3.98e-24	79	670	93	678	Probable alpha-galactosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglG PE=3 SV=1
sp|P27756|AGAL_STRMU	1.50e-22	71	618	101	622	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3
sp|P43467|AGAL1_PEDPE	4.72e-22	210	703	214	711	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FVEG_09872-t26_1-p1.