CAZyme Information: FVEG_09048-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_09048-t26_1-p1
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
685	CM000582.1|CGC21	76915.00	5.1381

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000582.1:3083070-3085220(-)

Full Sequence      

MTYPRPDFERNPLRWESLNGQWDFLFDDGDSGLNENWQRKGLPEKVNVDTSANRKETGQN
DSVVQKIMGDAHSLIQNNVFASSTQTTNSKTKINVPYVFQSPASGINDRGVHEVMWYERV
ISDLRSAQEKEKGHKLVLRFGAVDYEASVWVNGEYVGGHRGGHVPFEIDITDAVDTAKDA
TTHRVTLRVYDSAYDLTQPRGKQYWAAKPETIFYTPSGGIWQSVWLEVVPSVRIADSSYG
TVIKSNDIQSGQLRSTIAVKGRRIGKGYSVELESSFAGIPVAKSDKKVLPRETSSVGVEL
NMRLSEEQRSKLSKSVTESAPLDNDFAWRDGVALWSPEHPQLYDLVIRLYDDAENVIDEV
KTTTGMRNINWTTGDGTWRLNDKPYFQALCLDQGYWPETFMTPPSSESLKLDIELAKKMG
LNGCRKHQKVEDPLFYYWADKLGFLVWGEIANAYAFSAEYVDRFNAEWTEAVKLVINRPS
VVTWTPVNESWAYPNLEDNADQRNHIRQLYHLTKCLDDTRSINDNCGWQHVLTDLTTFHD
YSDGPEIEKTCSTLEGIIGPKAGRGVFLPPIPGADEGSKHKPGAPVMNTEFGGVNIAPAK
KEDGDSLDWGYTTATNADDLVERIERLVNGVVLGGHCCAFVYTQLADIEQEVNGLYTFNR
EAKLDASKVKAVIDKALGAYYNRVK

Enzyme Prediction     

No EC number prediction in FVEG_09048-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	14	537	5.4e-91	0.4867021276595745

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	4.18e-30	16	563	13	462	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	4.23e-24	1	522	1	445	beta-D-glucuronidase; Provisional
236673	ebgA	1.63e-20	7	520	32	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	1.07e-12	16	230	2	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
395572	Glyco_hydro_2	3.03e-09	306	367	47	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD54841.1|GH2	0.0	1	685	1	685
QGI95766.1|GH2	0.0	1	685	1	685
QGI64883.1|GH2	0.0	1	685	1	685
CCT68937.1|GH2	0.0	1	685	1	685
QGI82136.1|GH2	0.0	1	685	1	685

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	4.59e-55	3	672	29	578	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6ED1_A	1.66e-18	80	493	43	425	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
5UJ6_A	6.62e-18	91	489	55	418	Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	6.66e-18	91	489	63	426	Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
6D8G_A	6.08e-17	91	489	63	426	D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPJ7|PLH8_FORAG	1.95e-21	93	520	82	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	8.63e-20	114	541	57	433	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|T2KM09|PLH16_FORAG	2.86e-17	100	490	96	433	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|P06864|BGA2_ECOLI	1.45e-13	132	523	124	473	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
sp|Q03WL0|BGAL_LEUMM	1.92e-13	16	490	46	457	Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) OX=203120 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FVEG_09048-t26_1-p1.