CAZyme Information: FVEG_08707-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_08707-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	CM000587.1|CGC17	64790.30	8.8193

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000587.1:1145611-1147800(+)

Full Sequence      

MPKFQALTLAALSCLHAATASAYPRQDGSLRTEYDYIIVGAGASGLTVANRLSEDPAVTV
LVIEAGDFDKNEDIVTIPGLAGGAVGTKYDWNLTYPSTTSLNGRNVSIPLGKVVGGSTKL
NRMVYDRGSKADYDRWAELGNSDWQWDTLLPYFKKNEKFSGPNADIKKEYGITTDPSAHG
SSGFIHTSYSPFFWPTTKNLVKATGELGISVAFDQANGGAIGGYFCPHNLNPKTVVRSSA
QDYYSAVSQRKNLQLLPGNQVTRILTSKDGSSVKTTGVEFAKNKGSAKNTVKAKKEVILA
AGAIHTPQILQVSGIGDSALLSSIDVPVVVDLPAVGQNFHDHVFLAVVGTVNAPIQTGNL
TGNATFAAEARAEYDQQKKGPYSSPTGDFLLFLPLSNATSSASDIHRQAASQDGSKFLPS
GTPAEVVKGYKKQQKVLNDKLLDAKSAILEVIWADGTSVLGLQHPYSRGSVKAKSSCIFD
SPDANPEFLKNPLDIAILTEGVKFARKLSGAPSIKSMNPFEIVPGANVTSDSDIEQFIRN
SASTLFHPAGSCKLGSRSDGGVVDEKLRVYGIKGLRIVDASVIPLLPATHTMTTVYAVAE
KAADLIKRG

Enzyme Prediction     

No EC number prediction in FVEG_08707-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	33	607	6.2e-188	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.83e-113	33	608	7	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	8.29e-105	33	609	5	533	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.23e-42	465	602	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.98e-36	97	342	10	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.65e-27	20	595	37	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGJ00970.1|AA3_2	0.0	1	609	1	609
CCT74664.1|AA3_2	0.0	1	609	1	609
QGI70079.1|AA3_2	0.0	1	609	1	609
QGI87441.1|AA3_2	0.0	1	609	1	609
QKD60653.1|AA3_2	0.0	1	609	1	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.15e-109	29	608	1	584	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	9.03e-96	4	606	3	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	2.19e-80	33	607	1	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.21e-79	33	607	2	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.17e-76	7	608	13	599	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	5.62e-109	6	606	13	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	5.62e-109	6	606	13	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5AUN2|XPTC_EMENI	1.64e-96	32	607	36	614	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	8.50e-86	6	608	3	631	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	6.03e-81	19	609	26	610	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000887	0.999069	CS pos: 22-23. Pr: 0.9286

TMHMM  Annotations     

There is no transmembrane helices in FVEG_08707-t26_1-p1.