CAZyme Information: FVEG_08463-t26_2-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_08463-t26_2-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	CM000587.1|CGC18	40574.99	9.0638

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000587.1:1797611-1798864(+)

Full Sequence      

MVRKSLNDGFQMTIKSVASISAHSSSSNDGWLKNHGRTWAAVPTTMNGHASKIASIGLNA
VRIPVGYWMYEDIIQKGEYWPRGGIWHLDRIVGWCKKHGIYAVIGLHSAPGISSPNEQFT
GHSIPNPGFYTAENYERAFKFLEWMTKRIHTNGNYTTVGMLEVLNEPVRAGKWKAEADDM
IKNYYPGAYKRIQAMEGYLKVPKADRLHIQYMGKSWGAGDPRLYLPDDDLIFFDAHRYLS
FDNRIAGNKKAYIETACKDNMGQHVFVGEWSLSVNSTLKNTDEFKIQGQETWYKAYWAAQ
AESFEKGDGWFFWSWKCDGELGKKDWRWCYQAAVAAGVIPKDASKAKSLSPCARYTE

Enzyme Prediction     

EC	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	32	331	1.5e-129	0.97

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	3.10e-11	34	315	14	268	Cellulase (glycosyl hydrolase family 5).
225344	BglC	5.28e-10	52	310	81	325	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT74918.1|GH5_15	2.19e-237	32	357	90	410
QKD60398.1|GH5_15	1.79e-236	32	356	90	409
QGI70318.1|GH5_15	2.32e-229	32	353	90	406
QGJ01207.1|GH5_15	2.32e-229	32	353	90	406
QPC76097.1|GH5_15	2.95e-214	32	355	90	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CZ1_A	7.87e-16	32	352	61	391	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
1EQP_A	7.87e-16	32	352	61	391	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PBO_A	8.13e-16	32	352	67	397	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PB1_A	8.13e-16	32	352	67	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	1.09e-15	32	352	66	396	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	7.93e-91	51	352	112	409	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|A1DGM6|EXGB_NEOFI	1.38e-86	51	352	103	399	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	2.47e-85	51	352	106	403	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|Q2TZQ9|EXGB_ASPOR	5.23e-85	52	342	105	391	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgB PE=3 SV=1
sp|B8NBJ4|EXGB_ASPFN	3.90e-81	52	337	105	386	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000005	0.000046

TMHMM  Annotations     

There is no transmembrane helices in FVEG_08463-t26_2-p1.