CAZyme Information: FVEG_07762-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_07762-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1546		169526.83	6.6241

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000585.1:49427-54387(-)

Full Sequence      

MLISYPQSCIFINSCNLSYVSRKIAKRVIDYSHHVAFHERGAYRRAGRRRAAVQAHNRRE
DFSTLRQATTTPSPPSINTNPRPLAGKDFWHTTPIPQHGIPSIRLSDGPNGIRGTRIFDS
VPSSCLPCGTALGATFDTDLLAQVGRLQGHEAKAKGAVVVLGPTMNIQRGPLGGRGFESF
SEDPVLSGHLAGYYCRGLQQENIAATLKHFVCNDMEDERMAVNIMVTQRALREIYLLPFQ
LALSIGDPQAVMTAYNQVNGTHVSENKELLQSILRDEWKFDGLVMSDWFGTYSTTGAIDA
GLDLEMPGPSRWRGRALSHAVMANKVTEAQLDDRVRNVLNLINYSKASEVPENSPEKQLN
RPEDQALLRRVSSQSIVLLKNENGILPFTKSKTTAVIGPNAKIARFCGGGSASLLPYYSV
SPYEGIAAQCQQKTLFSQGATDHQMLPLIGNYLKTPQGRRGFTWKAFNEPATSIGRRPIE
ERVLTDSNCFLMDYHNPDLAPVWYAQAEGIFTPDESGLYDFGLGVEGTGKLYIDDELLIS
NVENQTRGETLFGSGTIEEKGEKVLTAGQEYRIRLEWGCAKTSKLPPFGPVGGKHGGWRI
GCFKRIDPVQAIEDAVAVAKTVDQVVLVVGLNGELESEGTDRTHMDMSYSSNTLVTRVLE
ANPNTAVVVQSGTPVTMPWINNASAVCHAWYGGNETGNAIADVLFGDVNPGGKLPLTIPA
RLQDNPTFFNHRSEAGRVLYGEDVYVGYRYYEKIDSKPLFPFGHGLSYSTFALKDLSVQV
GATTTMMVQLSNTGLRSGSEVVQVYVAPPANTSVQRPVKELKAFRKVHLEAGESKQVTID
LDTVLSTSYWDEARDKWCSQAEVISEDSTLIITTTTITLSSPQSIRIVTADNSAAQIVEP
IQELLRSVTAHVGPACLFGSAGKAAENGTEAGAGLAQPRDDKTESRASFEQQSQIRTDNL
AGSGEKSTYYPDMDPSASAASPTSRIVMRQACDVCRLRKRKCSFGTGGGIRWTNTVLAPD
PTTRCDNCEKSDSQCTFQMPSKARGPKRKTGYRYSIGTAHSASASPEVDASDTVNASSPL
SPLPFSNPGPCVLEELAQEPSIAASASSAGCALPYPTDVLLPRDLIHFILNDYLVHVYPL
IPVIHRPSFKIDLERNSDLHDESFLILIISLCALTVCILPSRLQIYQDFSSPLPFRTRTE
MVNHCHKFCQSFRDASYFDTVSHDKWASSFLLGIAFHQAGNTNQWRMLEVEAMQLLRLLE
VHRVSSYAGLDAIEVQLRKKAFWLMFYGYVHQIHNLRNERLMFLDTMLSCELNLEDLMPA
PVDDEYISSSGLLPCPEDIAAASLTAGFNIHSRVFAAALRPPGSTGKQTCICNHLTDPQQ
RLVSLRERLHHLKYMLDTVSPAYGIWSKKTTAPTVPTSAATTSSTEGEEVGNIQREAIRV
NIHVTHLWLQSTLLDQIDALENEVSASASATQASMNLPPLSSSSSPVKPDTTFSPERESI
CQQLLYLLHSFSHYGLEPNGLSLVSIKGYSSGSLCFSANSDKTAGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	95	307	1.1e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	7.79e-88	127	842	121	726	beta-glucosidase BglX.
224389	BglX	8.60e-73	99	429	59	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.97e-57	376	748	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.71e-45	126	341	88	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	4.39e-39	98	842	92	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS75192.1|GH3	0.0	84	859	31	806
QPC74569.1|GH3	0.0	84	860	31	807
CEF71930.1|GH3	0.0	84	860	31	807
AMB48849.1|GH3	0.0	84	861	31	808
CEI63570.1|GH3	0.0	88	860	33	805

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.72e-242	84	861	22	814	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	9.63e-238	84	861	22	814	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	8.07e-121	85	901	22	700	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.59e-103	85	861	22	641	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	3.99e-93	95	857	87	802	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	0.0	85	860	23	808	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	0.0	85	860	23	807	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	0.0	85	860	23	807	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A2R989|BGLI_ASPNC	0.0	84	860	1	787	Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	0.0	85	860	23	808	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FVEG_07762-t26_1-p1.