CAZyme Information: FVEG_07760-t26_2-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_07760-t26_2-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
824		92680.95	6.4185

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000585.1:57107-59880(-)

Full Sequence      

MSISSETLSNIIKSIPPTQRSLVSDVTGARIPIVPNLTGVTAELSHYSRACIAHEERIVL
VWSQDPKAIINVADHVQQEVFEIMRTSSDGPLEKDIPTRSTSTQRSSSVAPAPYYVRGGL
DEKNEIFQRAVALEENEDDEADIERAAAPRPRLKMHAFKVTFAIMLVVVTQSLGVTKLLN
EYYWDGDATRFALVSTIPPLTLFSLFFFLVLVTSLFQLFLPVSVCLKNSRFHSAIKPNPK
RHRDYELPHITIQMPVYKEGLKGVIVPTMISVMAAIEYYEQQGGTASVFINDDGMQLIQP
DLAEARKAYYRENGIGYTARLPNLKSPKKGSWFRRSKESTTDSVEKPESEMTPQELANKI
GFQRRGKFKKASNMNYGLAFSNRVEDEMARLIQLECEQRGCAEADLTVDDDNLLYERALA
NMLAEDNGRTWAEGNIRIGELILLIDCDTRVPVDCLYYGALEMHESPEVAILQHGSGVMQ
VVHNMFENGITYFTNVVYTAIKYGVGSGDVSPFVGHNAFLRWKALQDIAFTDPTDNNQVK
WWSDSHVSEDFDISLRIQMKGMIVRLATYHNGGFKEGVSLTLYDELTRWEKYAYGCNELV
FHPFYQWPYKGPVTRLYLRFLWSNIPITSKVTITAYIFTYYAIASGLFLTVANYIIIGLF
PDKLDHLYMPSWGIWLSLVVIFNGLGSVAFSMARHQLKEEVFWKALLDAIKWLPFLIIFF
GGISLNCAKALICHACSINIEWASTAKEPGPSGFFIGLDKMIASFKYTWVICILIAAMMI
YFAVGAPWGYTITPGPHSTAMVAIIPLAIQICSAFFLPLTLGLN

Enzyme Prediction     

No EC number prediction in FVEG_07760-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	442	652	4.8e-53	0.9644670050761421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	2.61e-53	441	657	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	5.75e-10	439	717	138	402	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.03e-05	439	550	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS73743.1|GT0	0.0	1	824	159	986
CEF83741.1|GT0	0.0	1	824	159	986
UPK97459.1|GT0	0.0	1	824	159	984
CEI39823.1|GT0	0.0	1	824	159	915
QKD61408.1|GT0	0.0	1	824	150	968

PDB Hits     

FVEG_07760-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

FVEG_07760-t26_2-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

Start	End
160	179
191	213
637	659
672	694
709	728
769	791
801	823