CAZyme Information: FVEG_07678-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_07678-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		37039.03	8.8636

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000585.1:275061-276140(+)

Full Sequence      

MKLFVLISFATWLHAATAAAAPSVDKQSQKKFDFAKIKKIVSFYCKSDYVISGDSWTDTR
FNTSGTQPSSSNPFGNTGKTSSNGKMWPMYLTTRYNQSSVLLYNMAVGGAVTDINIVKTG
PNDVVTQVNRFDAYLQQLGSKFFSPKHTLYTVFIGINDIYRTINDADQNDTVIKIMERLG
ELTTDLHGHGARQFLFISTPPQSLFPNNVPKPIAPTLKAASENWNKQLQQLLKQLDRKLS
HSTFFLFDIVPLITAVTEDPSQFPETAMYKSTGFCADYKSGTITPDFKSDNCEYNASEYM
YIDGAHPTQAFHQILAKNIAEQLAVGRTIGRP

Enzyme Prediction     

No EC number prediction in FVEG_07678-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	53	319	5.8e-51	0.9775280898876404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.69e-38	49	322	2	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238883	Triacylglycerol_lipase_like	4.51e-14	47	323	2	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
238875	SGNH_plant_lipase_like	3.06e-11	53	319	7	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	3.43e-10	49	319	1	224	GDSL-like Lipase/Acylhydrolase.
225780	COG3240	1.58e-09	47	324	30	334	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL02720.1|CE16	8.64e-153	1	329	1	318
UQC91480.1|CE16	7.55e-50	34	324	28	316
UJO22905.1|CE16	6.72e-45	47	324	41	329
CBY01773.1|CE16	1.02e-41	51	323	41	325
ATZ46260.1|CE16	4.96e-41	51	329	49	340

PDB Hits     

FVEG_07678-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	2.05e-18	49	273	33	270	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	2.05e-18	49	273	33	270	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|P40603|APG_BRANA	2.70e-07	152	322	265	444	Anther-specific proline-rich protein APG (Fragment) OS=Brassica napus OX=3708 GN=APG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000227	0.999750	CS pos: 20-21. Pr: 0.6995

TMHMM  Annotations     

There is no transmembrane helices in FVEG_07678-t26_1-p1.