CAZyme Information: FVEG_07261-t26_2-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_07261-t26_2-p1
• CAZy Family: GH141
• CAZyme Description: endo-1,4-beta-xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		32655.60	4.3965

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000585.1:1529399-1530437(-)

Full Sequence      

MVHFTSVFAGLSLVAGSLAAPSKEGLFSKITKRAGTPNSSGTNNGFFYSWWSDGGADATY
TNGEGGSYSMEWKDGGNVVGGKGWSPGKARTISYEGEYKPNGNSYLSVYGWTRNPLVEYY
IVESFGTYNPSSGATKKGTVEADGSTYDIFETTRTNAPSIDGTQTFQQYWSVRQQHRSTG
SVDTGLHFDAWEKAGMKLGTHDYQILATEGYFSSGSSHMTVSEGASSGGSTGGDASQGGD
ASQGGDASQGGNGQQGDTQQPGNGQQGGDASQGGDASQGANGQQGGNGNSFQQPGSENQP
QQQEIDTGANEPCQ

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	44	219	8.7e-75	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	1.92e-106	44	217	1	174	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI85319.1|GH11	9.53e-180	1	314	1	308
CCT72437.1|GH11	9.53e-180	1	314	1	308
QGI68090.1|GH11	9.53e-180	1	314	1	308
QGI98975.1|GH11	9.53e-180	1	314	1	308
AAK27974.1|GH11|3.2.1.8	4.24e-173	1	314	1	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YNA_A	3.79e-94	36	223	3	192	ENDO-1,4-BETA-XYLANASE, ROOM TEMPERATURE, PH 4.0 [Thermomyces lanuginosus]
5JRM_A	1.01e-91	36	223	7	194	Crystal Structure of a Xylanase at 1.56 Angstroem resolution [Fusarium oxysporum],5JRN_A Crystal Structure of a Xylanase in Complex with a Monosaccharide at 2.84 Angstroem resolution [Fusarium oxysporum f. sp. vasinfectum 25433]
1PVX_A	1.34e-89	36	223	3	192	Chain A, Protein (endo-1,4-beta-xylanase) [Paecilomyces variotii]
6Y0H_A	5.25e-89	34	222	4	193	High resolution structure of GH11 xylanase from Nectria haematococca [Fusarium vanettenii 77-13-4]
4XQD_A	4.93e-86	40	222	6	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQD_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],5ZF3_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],5ZH0_A Crystal Structures of Endo-beta-1,4-xylanase II [Trichoderma reesei RUT C-30],5ZO0_A Neutron structure of xylanase at pD5.4 [Trichoderma reesei RUT C-30]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92245|XYN4_MAGGR	3.13e-101	1	221	1	229	Endo-1,4-beta-xylanase 4 OS=Magnaporthe grisea OX=148305 GN=XYL4 PE=3 SV=2
sp|G4NA54|XYN4_MAGO7	3.13e-101	1	221	1	229	Endo-1,4-beta-xylanase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL4 PE=3 SV=1
sp|Q06562|XYN1_COCCA	2.08e-99	1	221	1	218	Endo-1,4-beta-xylanase I OS=Cochliobolus carbonum OX=5017 GN=XYL1 PE=1 SV=1
sp|O43097|XYNA_THELA	5.54e-98	1	223	1	223	Endo-1,4-beta-xylanase OS=Thermomyces lanuginosus OX=5541 GN=XYNA PE=1 SV=1
sp|A1DNU5|XYNB_NEOFI	2.11e-94	1	222	1	221	Probable endo-1,4-beta-xylanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xlnB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000384	0.999578	CS pos: 19-20. Pr: 0.9836

TMHMM  Annotations     

There is no transmembrane helices in FVEG_07261-t26_2-p1.