CAZyme Information: FVEG_07167-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_07167-t26_1-p1
• CAZy Family: GH132
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
562		60880.51	6.5663

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000585.1:1766285-1768081(-)

Full Sequence      

MKSFLSLALLPLALLIDSSSATSASCRCLPSDKCWPADSVWAKFNTTVNGALIKTVPLGS
PCHDPNYDEAACAAVKDSWKWPMTHIETSSSVMQNWFANQSCDAFTAEEKPCTLGNYVSY
AVKVSDARQVAAAVQFANYYNIRLVVRNTAHDYFGRSTGAGGLAVWTHHLKNTEVVQWAD
KTYNGPAFKLGAGIQGFDSVEYADSQGLTSVPGECPTVGLAGFTLGGGHSPLSSSYGLGA
DNTLEFEVVTAAGRIVRASATENSDLYWALSGGGGASFGIVTSMTVRAHKTTTIGGATLT
LVAGTDQDVFYNAVAKFHELLPAMIDHDATVTYILTSAYLSIKPVTIANSTGDYVRDEVL
APFTDYLSKAGLTPTVSYTTLSFRDHYELYNGPLPGGHLEASQFQFGGRLIPRSVLETDN
ANFIKVLRNFGAAGVLVAGSSGKFEAYPGVSNGVPSYWRKAAISLQFGTLWDSTRWSDMI
ADQKKITEVYMPQLKAVTPGSGTYMNEADFNEPDWKNVFYGTNWDRLNTIKRKWDPKSFF
YNFKGVGSEAWTVAKDGRMCRA

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	124	301	1.6e-43	0.37554585152838427

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.25e-21	119	259	2	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	4.86e-20	122	549	36	459	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	2.22e-11	503	547	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	2.47e-05	242	282	193	232	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	6.74e-64	16	561	488	1065
QKD57322.1|CBM91|GH43_11	6.74e-64	16	561	488	1065
UQC87672.1|AA7	3.04e-23	122	548	74	497
UNI23960.1|AA7	6.88e-16	123	289	53	215
RDX44700.1|AA7|1.1.3.-	8.04e-16	125	290	76	235

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	1.16e-132	7	562	9	574	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	3.34e-58	26	561	30	597	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6EO5_A	7.79e-21	129	540	59	462	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6EO4_A	1.04e-20	129	540	59	462	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6FYE_A	7.19e-20	113	540	40	453	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0E0RTV6|ZEB1_GIBZE	3.80e-167	23	562	24	563	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|G0R6T3|SORD_HYPJQ	4.51e-146	19	561	32	572	FAD-linked oxidoreductase sor8 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=sor8 PE=3 SV=1
sp|G2QDQ9|VAO15_MYCTT	5.95e-132	7	562	9	574	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1
sp|A0A075TR33|PATO_PENEN	1.08e-131	16	562	18	567	FAD-linked oxidoreductase patO OS=Penicillium expansum OX=27334 GN=patO PE=1 SV=1
sp|A1CFM2|PATO_ASPCL	3.53e-130	23	561	26	567	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000179	0.999764	CS pos: 21-22. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in FVEG_07167-t26_1-p1.