CAZyme Information: FVEG_06900-t26_2-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_06900-t26_2-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397		45841.29	5.0877

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000584.1:1128698-1130028(+)

Full Sequence      

MLKAAFITALVALTTSASAWLPNTEPHAMNERDNEIFVYPLRTDPNNKRWLPATKKIRGV
NLGSLFIYEPWIDSQEWANTGCEGEKSEFDCVMNKGQDVADKNFQAHWKRWINQTDLDEM
LSYGLNTIRVPLGYWLKEDVDNSEHFPKGGLEYLTQLCGWASDRGLYIILDLHGAPGAQE
PNQPFTGQYAPTSGFYSGYNYDRAIEWLEWMADIIHTKKEYRNVGMLELVNEPLNRDKAV
DSLRKTYYPEAYSAIRNVEDKLKVTSKDRLHIQMMGSLWGSGKPTEFLGDTSFTAFDDHR
YLKWDTSVEVSHGAYIKKSCSDDRNTDGPTIVGEWSLAVPDDVEKTDAWNPQTQKEFYTK
WFSAQVHAYEKHTLGWVFWTWKANLGDDYRWSYRGEL

Enzyme Prediction     

No EC number prediction in FVEG_06900-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	96	394	2.3e-148	0.9966666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.38e-21	56	389	17	370	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.50e-08	111	384	24	271	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK93324.1|GH5_15	1.48e-251	1	394	1	395
CCT71223.1|GH5_15	1.70e-208	6	397	6	327
QGI66947.1|GH5_15	1.70e-208	6	397	6	327
QGI97833.1|GH5_15	1.70e-208	6	397	6	327
QGI84184.1|GH5_15	1.70e-208	6	397	6	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	9.20e-32	46	394	3	375	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1EQP_A	1.17e-31	50	394	2	370	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PB1_A	1.29e-31	46	394	4	376	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PF0_A	1.29e-31	46	394	4	376	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	3.38e-31	46	394	4	376	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	1.90e-171	6	397	3	391	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|Q0C8Z0|EXGB_ASPTN	3.57e-163	11	397	12	385	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	6.79e-160	7	397	5	381	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	9.68e-159	7	397	5	381	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|Q4X1N4|EXGB_ASPFU	1.12e-157	7	397	5	381	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000348	0.999621	CS pos: 19-20. Pr: 0.9740

TMHMM  Annotations     

There is no transmembrane helices in FVEG_06900-t26_2-p1.