CAZyme Information: FVEG_06900-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_06900-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	CM000584.1|CGC8	47451.16	5.0964

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000584.1:1128698-1130126(+)

Full Sequence      

MLKAAFITALVALTTSASAWLPNTEPHAMNERDNEIFVYPLRTDPNNKRWLPATKKIRGV
NLGSLFIYEPWIDSQEWANTGCEGEKSEFDCVMNKGQDVADKNFQAHWKRWINQTDLDEM
LSYGLNTIRVPLGYWLKEDVDNSEHFPKGGLEYLTQLCGWASDRGLYIILDLHGAPGAQE
PNQPFTGQYAPTSGFYSGYNYDRAIEWLEWMADIIHTKKEYRNVGMLELVNEPLNRDKAV
DSLRKTYYPEAYSAIRNVEDKLKVTSKDRLHIQMMGSLWGSGKPTEFLGDTSFTAFDDHR
YLKWDTSVEVSHGAYIKKSCSDDRNTDGPTIVGEWSLAVPDDVEKTDAWNPQTQKEFYTK
WFSAQVHAYEKHTLGWVFWTWKANLGDDYRWSYRDAARAGVIPKDLDSLPSVC

Enzyme Prediction     

No EC number prediction in FVEG_06900-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	96	394	2.6e-148	0.9966666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.29e-22	56	413	17	394	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.74e-08	111	384	24	271	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK93324.1|GH5_15	6.68e-266	1	413	1	414
CCT71223.1|GH5_15	4.29e-206	6	394	6	324
QGI66947.1|GH5_15	4.29e-206	6	394	6	324
QGI97833.1|GH5_15	4.29e-206	6	394	6	324
QGI84184.1|GH5_15	4.29e-206	6	394	6	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	1.35e-33	46	413	3	396	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1EQP_A	1.71e-33	50	413	2	391	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PB1_A	1.89e-33	46	413	4	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PF0_A	1.89e-33	46	413	4	397	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	4.98e-33	46	413	4	397	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	6.59e-181	6	409	3	403	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|Q0C8Z0|EXGB_ASPTN	2.05e-171	11	408	12	396	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	3.90e-168	7	409	5	393	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q2TZQ9|EXGB_ASPOR	1.14e-161	2	409	1	395	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	2.02e-157	7	394	5	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000348	0.999621	CS pos: 19-20. Pr: 0.9740

TMHMM  Annotations     

There is no transmembrane helices in FVEG_06900-t26_1-p1.