CAZyme Information: FVEG_06833-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_06833-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623		68240.97	4.7449

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000584.1:930872-933136(-)

Full Sequence      

MLFGNFGLAFLTLFFLPLAESLHVTPEIADEQLRDVYDYIIVGGGTAGLIIANRLSENPA
VLESGPLDDARNLSIPGGLLPVPGTIGSGGGQKYQWELTTEPQTYLNNQNVEVPQGKAVG
GSSILNGLCWSRGSVSDYDDWQKLGNKGWSWNDLLPYFKKSEKFTFNVEPHDTEKLHIRP
QSAEHGYNGSVHVSYPQYFYDQSSNILDGFAELGLPIIGDVNNGTAAGAMILPSSMHPDN
QTRFDAREAHFNSVSSRYNLHIATNQTVTQLVLDSDSAYSSSQRVMGVEFALDDKSKVRS
VSCTREVIVSAGAIFTPTLLQVSGIGPSDVLKSLDIPVKIDLPGVGCNLQDHPMVYANYY
YRNESYFTSGEITDDVYDEVAVEYIRNRTGPWTAPLINTVAFPSLRCATDDWKQFMNKSS
GDGIPSNTSNSVKKGYEVQKKILQDQILSNDTGIFETMANSQGQLTVAAQKTFSRGTVRP
SSSSIFDLPKLDLRYCSDPIDCEIIVLGLQMNAKLIQTDAMKELMPGAESAFDTTDHETL
MKHVMEKITTERHHSGTAAMMPLELGGVVDPELKVRGTCNLRIADASIMPLIPSANLQAS
VYTIAEKAADMIKSAKPDCRIIE

Enzyme Prediction     

No EC number prediction in FVEG_06833-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	37	614	4.3e-170	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.61e-99	37	617	6	536	choline dehydrogenase; Validated
225186	BetA	1.02e-96	37	617	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	1.09e-35	107	353	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.50e-35	473	608	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	9.28e-23	37	601	56	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI66885.1|AA3_2	0.0	1	620	1	599
QGI97771.1|AA3_2	0.0	1	620	1	599
QGI84122.1|AA3_2	0.0	1	620	1	599
CCT71164.1|AA3_2	0.0	1	620	1	597
UPK94759.1|AA3_2	3.18e-310	16	619	16	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	5.29e-95	37	613	6	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	8.28e-77	31	612	30	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4YNT_A	2.58e-70	37	613	6	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.19e-69	37	614	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.36e-69	37	614	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	2.04e-88	18	613	19	614	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	7.94e-86	37	612	47	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	7.94e-86	37	612	47	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	7.29e-69	16	613	20	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.19e-64	37	613	41	608	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000699	0.999279	CS pos: 21-22. Pr: 0.9666

TMHMM  Annotations     

There is no transmembrane helices in FVEG_06833-t26_1-p1.