CAZyme Information: FVEG_06710-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_06710-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	CM000584.1|CGC14	43339.20	7.0901

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000584.1:564462-565577(+)

Full Sequence      

MVPKALPRGILVIGICSLLWWALRTLQGSYAVFAESLQSIDLLSPTLDHDWKTSELYAFK
ATHDLCSAHGYSAFVPKSPSRERKIYDMLMINDELDFLEIRLDALYDYVDYFIIAESAKT
FQANSKPLILKDNWDRFRRYHDKVMYHELTFPSSFDPHRPWDYEDLQRDAPFDQVMLHLD
GPRAPNKGDVLVVADVDEIPRPQTLLILQYCNFPRRLTLSSKFYYYSFQFLHAGPEWQHS
QATYYQGHQTLKPTNLRNGDGGFRPLRFLERGVLSNAGWHCSSCFPTTDQFLNKMASFSH
RWMNREEYRDKDKITAAVREGKDLWGREQDQFVRIENNKDMPPLVLRQPKRFGYMISRDG
LSAGFVDYSGN

Enzyme Prediction     

No EC number prediction in FVEG_06710-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	63	355	1.8e-77	0.9788732394366197

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	1.81e-46	63	326	58	300	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD58150.1|GT17	1.60e-251	1	370	1	370
CCT71044.1|GT17	1.34e-242	1	369	1	369
QGI83999.1|GT17	1.34e-242	1	369	1	369
QGI66762.1|GT17	1.34e-242	1	369	1	369
QGI97648.1|GT17	1.34e-242	1	369	1	369

PDB Hits     

FVEG_06710-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

FVEG_06710-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.906338	0.093685

TMHMM  Annotations     

There is no transmembrane helices in FVEG_06710-t26_1-p1.