CAZyme Information: FVEG_05700-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_05700-t26_1-p1
• CAZy Family: GH11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	CM000580.1|CGC19	40143.14	8.5538

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000580.1:4396515-4397782(-)

Full Sequence      

MKFTLYLSALTALLTPITAQKLSGSAQGFAQGVTGGGSAAVVTPKNIQELVTYLTDKTPR
VIVLDRTYDFIDSEGTVKEKGCAPWKTGAGCQLAINAAGNWCGDNPKVDVTYSKAGTSGI
NVASDRRLSGLGIRVSSRGRDCDLLMSEHYCSKHHITNLTPQYVWGGDAFTFSGTSKIWI
DHCTTSLLGRQHYVFGRDKSTGITLSNNHIDGRTQWSAGCDGYHYWTIEMVGQGDQITLQ
NNLIEHTAGRGPALSATTFLHAVNNVWRDINGHAIEGDTAGKGLFEGNVFQNVKQVVVPD
FKGQLNSCPDNAAASATKQYLGRVCQGNIFISSSAFNRKDTGFMSEFKGLPIARSTQATT
AQSKVPGNAGFGKI

Enzyme Prediction     

EC	4.2.2.10:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	110	292	1.1e-61	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.36e-27	109	294	1	190	Amb_all domain.
226384	PelB	7.40e-10	3	292	5	275	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	0.002	167	290	79	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT66530.1|PL1_4	1.21e-246	1	374	1	375
CEF77859.1|PL1_4	1.41e-245	1	374	1	375
CEI61602.1|PL1_4	8.14e-245	1	374	1	375
QPC59181.1|PL1_4	8.14e-245	1	374	1	375
CZS81153.1|PL1_4	1.64e-244	1	374	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	1.97e-106	22	374	3	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.90e-101	22	374	3	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	2.62e-93	24	373	5	359	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UCT7|PELC_ASPOR	1.30e-120	1	374	1	375	Probable pectin lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelC PE=3 SV=1
sp|B8N6W5|PELA_ASPFN	1.30e-120	1	374	1	375	Probable pectin lyase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelA PE=3 SV=1
sp|A2QW65|PELC_ASPNC	1.73e-120	18	374	17	373	Probable pectin lyase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelC PE=3 SV=1
sp|Q5MBK3|PELC_ASPNG	4.09e-120	18	374	17	373	Probable pectin lyase C OS=Aspergillus niger OX=5061 GN=pelC PE=3 SV=1
sp|A1CFS2|PELA_ASPCL	2.29e-114	1	374	1	378	Probable pectin lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999698	CS pos: 19-20. Pr: 0.9793

TMHMM  Annotations     

There is no transmembrane helices in FVEG_05700-t26_1-p1.