CAZyme Information: FVEG_05642-t26_2-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_05642-t26_2-p1
• CAZy Family: GH106
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		42479.62	3.7578

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000580.1:4209221-4210456(-)

Full Sequence      

MKNAAALLTLLPLVAAHGFVKSPPPRKPGNAFKAACGDQPFYQQSADINGNVQGIKQVVG
SNFDAKECNLWLCKGFQFDDNKDNVQSYKLGEKIDFDVNIAAPHTGYANVSVVKTSTDKM
IGEPLIEFENYAANAGLNPNNTAFSVTLPESLGGECTKAGDCVLQWFWDAPDINQTYESC
VDFVVGAGSGSGSGSTKPSSAASAAPVATSAPAAEKPTATTLQAVAVTSSALGPIFESVT
TAVPEPTATTPDAGDDEDCDDEEPVDEGDDEDCDDEEEPTPTAAAETGDDEDCDEDEEPE
TGDDDEECPADDGDEYDTQPATPSNTAQGISAAANTAAVTKTRHNAYPVPKPTGQSSSDK
TGSGSKGSNNNNNAGSNNNAGSNTIVTSYVTVSAAETHYVTVTADAPACTA

Enzyme Prediction     

No EC number prediction in FVEG_05642-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA16	17	183	1.3e-71	0.9940119760479041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	1.96e-08	17	183	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI93558.1|AA16	1.76e-237	1	411	1	422
QGI62665.1|AA16	1.02e-236	1	411	1	422
CCT66471.1|AA16	2.51e-236	1	411	1	418
QKD50697.1|AA16	9.12e-203	1	411	1	404
QPC65560.1|AA16	6.29e-120	1	231	1	259

PDB Hits     

FVEG_05642-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

FVEG_05642-t26_2-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000368	0.999617	CS pos: 16-17. Pr: 0.9696

TMHMM  Annotations     

There is no transmembrane helices in FVEG_05642-t26_2-p1.