CAZyme Information: FVEG_05304-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_05304-t26_1-p1
• CAZy Family: GH10
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	CM000580.1|CGC7	55728.23	5.3873

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000580.1:3191019-3192547(+)

Full Sequence      

MSLPKDFQWGFATASYQIEGAVDKDGRGPANWDTFCAKPGKIADGSSGVTACDSYNRTAE
DIALLKSVGAKAYRFSLCWSRIIPLGGRNDPINQAGVDHYRKFVDDLLEAGITPFITLFH
WDVPDELDRRYGGLLNREEFPLDYERYARVVFESIPRCKNWITHNEPWCSAILGYSTGSN
APGRCSDRKKSEVGDSSTEPWIVGHNLLVAHGRAVKIYREEFKPKNGGEIGITLNGDATY
PWDPKDPRDVEAAERKIEFAISWFADPIYFGDYPASMRAQLGDRLPTFTPEEKALVLGSN
DFYGMNHYTANYVKHREGEAAPEDYVGNLELHFWNHRGDCIGEETQSTWLRPCALGFRDL
LVWISKRYGFPRIYVTENGTSIKGENDMPREKILQDDFRVKYYDDYVRAMADASRLDGVD
VHGYFAWSLLDNFEWAEGYETRFGVTYVDYENDQKRYAKKSAQHLKPLFDSLIKHEEHVV
NGNGVKAGQT

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	469	6.2e-154	0.9790209790209791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	2.26e-167	2	462	4	441	Glycosyl hydrolase family 1.
225343	BglB	2.64e-132	1	471	2	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	5.06e-104	2	462	27	473	beta-glucosidase
215455	PLN02849	3.68e-103	4	490	31	497	beta-glucosidase
184102	PRK13511	4.82e-98	2	473	4	467	6-phospho-beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD51034.1|GH1	0.0	1	490	1	490
CCT66182.1|GH1	0.0	1	490	1	490
QGI93265.1|GH1	0.0	1	490	1	490
QGI79540.1|GH1	0.0	1	490	1	490
QGI62370.1|GH1	0.0	1	490	1	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	7.83e-293	1	476	24	499	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	4.42e-284	3	476	3	466	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	1.21e-281	1	476	1	466	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	9.97e-281	3	476	22	485	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	6.07e-279	3	473	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	1.77e-191	3	473	11	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	1.13e-175	3	473	6	460	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q8L7J2|BGL06_ORYSJ	5.56e-139	2	468	49	518	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q339X2|BGL34_ORYSJ	1.11e-138	2	471	37	508	Beta-glucosidase 34 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU34 PE=2 SV=1
sp|Q9M1D0|BGL16_ARATH	2.02e-137	4	468	36	499	Beta-glucosidase 16 OS=Arabidopsis thaliana OX=3702 GN=BGLU16 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000008

TMHMM  Annotations     

There is no transmembrane helices in FVEG_05304-t26_1-p1.