CAZyme Information: FVEG_04324-t26_6-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_04324-t26_6-p1
• CAZy Family: CE3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		40388.66	4.7100

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000581.1:66109-67288(+)

Full Sequence      

MASIRLLATVTLLIVIASAQQCNLKTLKSSYQAPVTADGWNYSIIANELRRPRGILFDSE
GALIVIDSGNGIIHFELDDEGGTCLQVKKKTTLLKKNNLNHGIALSKDGRTIYASSSDEV
FAWSYDPSKVTLSESSAQTLVNNMTNGGHTSRTLLISQKHPDMLLVSRGSDGNDDAGAED
RDSGRSQIRAFNISSFSGNSDKKPYDYLDGEIIGWGLRNSVGVAEHPETGGIFSVENSAD
ELHRDGKDIHKDNPGEEMNFHGYLNGSDDQGGNYGYPLCYTLWSTEDFPNLGDLKIGDQF
PADRQADGDDATALTDEECKSDYVAPVLAFQAHTAPLDLKFDENGTRAYVSFHGSCKNPL
PTFNLGSLLKH

Enzyme Prediction     

No EC number prediction in FVEG_04324-t26_6-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	27	358	2.6e-137	0.8054862842892768

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	6.31e-16	32	355	49	341	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].
271320	NHL	0.005	31	113	40	116	NHL repeat unit of beta-propeller proteins. The NHL(NCL-1, HT2A and LIN-41)-repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures. The repeats have a catalytic activity in Peptidyl-glycine alpha-amidating monooxygenase; proteolysis has shown that the Peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL) activity is localized to the repeats. Tripartite motif-containing protein 32 interacts with the activation domain of Tat. This interaction is mediated by the NHL repeats.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50391.1|AA12	2.47e-236	1	359	1	360
CEI41287.1|AA12	3.00e-194	11	361	15	369
QPC72375.1|AA12	1.43e-189	11	361	15	366
CEF82837.1|AA12	8.23e-189	11	361	15	366
ESU15820.1|AA12	8.23e-189	11	361	15	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1T_A	6.97e-120	22	361	1	333	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1Q_A	7.47e-119	27	361	4	331	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	7.72e-119	27	361	5	332	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	4.25e-54	31	361	13	329	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

FVEG_04324-t26_6-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000242	0.999736	CS pos: 19-20. Pr: 0.9815

TMHMM  Annotations     

There is no transmembrane helices in FVEG_04324-t26_6-p1.