CAZyme Information: FVEG_04324-t26_4-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_04324-t26_4-p1
• CAZy Family: CE2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337		36089.07	4.2899

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000581.1:66602-67666(+)

Full Sequence      

MTNGGHTSRTLLISQKHPDMLLVSRGSDGNDDAGAEDRDSGRSQIRAFNISSFSGNSDKK
PYDYLDGEIIGWGLRNSVGVAEHPETGGIFSVENSADELHRDGKDIHKDNPGEEMNFHGY
LNGSDDQGGNYGYPLCYTLWSTEDFPNLGDLKIGDQFPADRQADGDDATALTDEECKSDY
VAPVLAFQAHTAPLDLKFDENGTRAYVSFHGSWNRDPPVGYKVSYVDFQDGKPASSSRST
NATTPIIYNKDLSKCPDDCFRPVGLAWDSKGRLWFSSDKTGEIFVLSHESGSGTSGGNGS
ESGAGSGDDDNDSASLQPGSAAFIIALAAFIVGGLLA

Enzyme Prediction     

No EC number prediction in FVEG_04324-t26_4-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	1	286	7.7e-129	0.7007481296758105

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	4.32e-14	2	278	173	385	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50391.1|AA12	9.96e-220	1	337	144	480
CEI41287.1|AA12	3.40e-172	1	337	148	487
QPC72375.1|AA12	3.66e-171	1	337	148	485
QPC63491.1|AA12	4.23e-170	1	337	148	485
CEF82837.1|AA12	8.52e-170	1	337	148	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1Q_A	9.53e-108	1	286	121	400	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	9.84e-108	1	286	122	401	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	1.02e-107	1	286	123	402	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	3.40e-53	1	286	119	408	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q44091|SNDH_GLULI	1.09e-12	6	278	210	433	L-sorbosone dehydrogenase OS=Gluconacetobacter liquefaciens OX=89584 PE=4 SV=1
sp|O51055|Y024_BORBU	3.26e-07	68	289	192	377	Uncharacterized protein BB_0024 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0024 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000011

TMHMM  Annotations     

There is no transmembrane helices in FVEG_04324-t26_4-p1.