CAZyme Information: FVEG_03727-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_03727-t26_1-p1
• CAZy Family: CBM63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		32559.39	4.5049

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000579.1:3931351-3932350(+)

Full Sequence      

MKMFNALLTGLYGSFLAHAYPVDHPAKFSRLVVFGDSFSDNGNGSWVVSNGTWPVDPAYY
RHSFSNGPKWNDVVAEKLGLELINLATGGATTNNDFVAGGTGAESTIPVPSAADQVLSFL
SWDQPQAGDIFVHWIGANDILFNTSITGAQVTSLINENVNRLFQAGAKTIILANYLNATT
FPATFNSSAYNVPSVQEYVPALTKGLEQIAAGYSAYAKTAVVDVQDLFNDMFSDPEAYGF
DEDYVNPPTACLTGVYTSEGVPRHLCSDPEKHIFFDSYHPVKEVHALVAKLFVKSIEGFS
A

Enzyme Prediction     

No EC number prediction in FVEG_03727-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	31	292	2.2e-23	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	4.30e-60	30	293	1	268	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.47e-25	33	296	5	315	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	3.56e-22	28	296	1	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
225780	COG3240	7.09e-21	3	289	1	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
185279	PRK15381	2.33e-13	29	285	143	390	type III secretion system effector.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI61065.1|CE0	2.28e-214	1	301	1	301
QPC72470.1|CE0	4.74e-168	3	300	1	300
QPC63584.1|CE0	1.36e-167	3	300	1	300
UPL02629.1|CE0	3.68e-153	5	300	4	298
UJO20625.1|CE0	7.46e-113	26	297	29	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JL1_A	7.28e-21	21	290	137	404	Crystal structure of VvPlpA G389D from Vibrio vulnificus [Vibrio vulnificus]
6JL2_A	3.42e-20	21	290	137	404	Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus],6JL2_B Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus],6JL2_C Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus]
6JKZ_A	6.35e-20	21	290	137	404	Crystal structure of VvPlpA from Vibrio vulnificus [Vibrio vulnificus],6JL0_A Crystal structure of VvPlpA from Vibrio vulnificus [Vibrio vulnificus]
6UQV_A	1.92e-15	18	290	1	279	Crystal structure of ChoE, a bacterial acetylcholinesterase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],6UQW_A Crystal structure of ChoE in complex with acetate and thiocholine [Pseudomonas aeruginosa PAO1],6UQW_B Crystal structure of ChoE in complex with acetate and thiocholine [Pseudomonas aeruginosa PAO1],6UQX_A Crystal structure of ChoE in complex with propionylthiocholine [Pseudomonas aeruginosa PAO1],6UQX_B Crystal structure of ChoE in complex with propionylthiocholine [Pseudomonas aeruginosa PAO1]
6UR1_A	4.90e-15	18	290	1	279	Crystal structure of ChoE S38A mutant in complex with acetate and acetylthiocholine [Pseudomonas aeruginosa PAO1],6UR1_B Crystal structure of ChoE S38A mutant in complex with acetate and acetylthiocholine [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99289|HLT_VIBPA	9.13e-20	25	295	141	409	Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=VPA0226 PE=1 SV=2
sp|P10480|GCAT_AERHY	2.59e-18	1	256	1	248	Phosphatidylcholine-sterol acyltransferase OS=Aeromonas hydrophila OX=644 PE=1 SV=3
sp|Q93X94|EXL6_ARATH	3.92e-12	27	296	26	338	GDSL esterase/lipase EXL6 OS=Arabidopsis thaliana OX=3702 GN=EXL6 PE=1 SV=1
sp|Q8VY93|GDL66_ARATH	3.32e-11	26	294	25	344	GDSL esterase/lipase At4g26790 OS=Arabidopsis thaliana OX=3702 GN=At4g26790 PE=2 SV=1
sp|A7J2C6|AES1_HYPJE	4.76e-10	20	300	20	339	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000257	0.999709	CS pos: 19-20. Pr: 0.9810

TMHMM  Annotations     

There is no transmembrane helices in FVEG_03727-t26_1-p1.