CAZyme Information: FVEG_03470-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_03470-t26_1-p1
• CAZy Family: CBM21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	CM000579.1|CGC5	39124.71	7.9746

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000579.1:4592397-4593667(+)

Full Sequence      

MRLEILFAPAFAAFVRAAGVTGAAEGFAKGVTGGGSAATVTPTTTAQLVSYLGDSSARVI
ILDRTFDFTGTEGTTSATGCAPYGTASACQLAINKDDWCTNYQPNAPKVSVKYDNAALNP
ILVGSNKSLVGVGSNGIIKGKGLYIAKGAKNVIIQNIHITNLNPQYVWGGDAIALDNTDL
VWIDHVTTSLIGRQHIVLGNNPSNRVTISNHKLDGATSWSATCNGYHYWGFYFTGSADTV
TFKNNYIYKTSGRAPKVGGNTLLHAVNNYWYDNVGHAFEIGAGGQVVAEGNIFQNVATPL
EASSFAGKLFASPSTSANAVCSSYLGHVCQVNGFGSSGTLSGSTTDFLVNFSGKNVASAA
AYSSITGLSSSAGFGTI

Enzyme Prediction     

EC	4.2.2.10:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	111	295	2.3e-88	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.10e-56	108	296	1	189	Amb_all domain.
366158	Pec_lyase_C	2.90e-16	114	293	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
226384	PelB	5.82e-15	121	300	97	280	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT64989.1|PL1_4	6.53e-250	1	377	1	377
QGI92197.1|PL1_4	6.53e-250	1	377	1	377
QGI61299.1|PL1_4	6.53e-250	1	377	1	377
QGI78479.1|PL1_4	5.36e-249	1	377	1	377
QKD53693.1|PL1_4	1.79e-247	1	377	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	2.57e-162	19	365	2	346	Pectin Lyase A [Aspergillus niger]
1IDJ_A	9.84e-160	19	365	2	346	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	1.17e-153	18	359	1	341	Pectin Lyase B [Aspergillus niger]
1PCL_A	3.79e-13	114	293	69	276	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
1VBL_A	6.47e-07	121	293	128	330	Structure of the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA61|PELB_EMENI	6.04e-184	1	362	1	363	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|Q4WIS6|PELB_ASPFU	1.42e-177	17	377	18	378	Probable pectin lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelB PE=3 SV=1
sp|B0XT36|PELA_ASPFC	1.42e-177	17	377	18	378	Probable pectin lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelA PE=3 SV=1
sp|A1CYC2|PELA_NEOFI	2.33e-176	17	377	18	378	Probable pectin lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pelA PE=3 SV=2
sp|Q4WV10|PELA_ASPFU	1.02e-175	1	365	1	367	Probable pectin lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000351	0.999631	CS pos: 17-18. Pr: 0.9376

TMHMM  Annotations     

There is no transmembrane helices in FVEG_03470-t26_1-p1.