CAZyme Information: FVEG_03441-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_03441-t26_1-p1
• CAZy Family: CBM13
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491	CM000579.1|CGC16	56494.96	5.4018

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000579.1:4656105-4657580(-)

Full Sequence      

MGSHQFDESIKGALPRDFIWGFATAAAQVEGAWNKDGKGLSIWDTFAHIPGKVKDGSSGD
DAVKSYDLYKTDVEWLRKYKVTGYRFSLSWSRIIPMGGKDDPVNEEGISYYSRLIDELLA
NKITPFVTLFHWDIPQALEDRYGGMLNKDAYTPDFVRYARVCFERFGDRVKNWITYNEPG
VYSLAGYAAGVHAPGRSSFRDRNEEGNSSTEPFIVSHTELVSHAYVADMYKREFKPKQKG
IIMITLHGNWSEPWDVDDPLDQEASERAREFEIAWFGDPLYKTGDYPESMRAQLGDRLPR
FTPEESRLVLGSSESYGMNSYSAFYVRHRDGPADINDHLGNVEKLDENKKGEWRGPMSDT
YWLRTTPWGWAKLLRWIWNRYGIPIYITENGTTAQGEHGWKPKSPDDVLEDSFRVDFYKS
YLTEVAKASQEGIVIKSYFGWTFTDNWEWAAGFSDRFGATWIDFESEDKTRYAKRSGYFL
GAFLNHLISKN

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	11	485	1.4e-142	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	1.43e-152	11	491	2	451	Glycosyl hydrolase family 1.
225343	BglB	4.04e-121	13	478	3	444	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	3.24e-102	7	488	21	484	beta-glucosidase
215455	PLN02849	1.03e-101	11	484	27	480	beta-glucosidase
215539	PLN02998	1.65e-93	14	484	31	485	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53715.1|GH1	0.0	1	491	1	491
CCT65005.1|GH1	0.0	1	489	1	489
QGI61314.1|GH1	0.0	1	489	1	489
QGI78494.1|GH1	0.0	1	489	1	489
QGI92212.1|GH1	0.0	1	489	1	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	1.52e-168	2	490	18	498	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	1.61e-167	14	490	3	465	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	3.23e-167	14	490	3	465	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	6.18e-167	14	490	22	484	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
6KHT_A	1.12e-166	13	470	20	476	Chain A, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_B Chain B, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_C Chain C, Glycoside hydrolase family 1 [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	1.12e-159	14	480	11	467	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	2.58e-149	14	490	6	462	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	5.88e-129	11	486	30	504	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1
sp|Q9FZE0|BGL40_ARATH	2.84e-128	11	485	34	507	Beta-glucosidase 40 OS=Arabidopsis thaliana OX=3702 GN=BGLU40 PE=2 SV=1
sp|Q8L7J2|BGL06_ORYSJ	8.00e-128	11	484	47	519	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FVEG_03441-t26_1-p1.