CAZyme Information: FVEG_03351-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_03351-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234		24657.52	6.8107

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000582.1:195232-196059(-)

Full Sequence      

MFNTAFVASLFLLPLATGAPAVEIEERQAPCHNVHIFLARGTDEPYPGRQSSIVSAVCSG
LTSCDYEDINYPANFNTYCTSIYAGINGGLSQVMAYANRCPDSKLVLSGYSQGAQLFGDM
LGGGGGQSLGCTQQSNSALNPATSPGNKIAAVLFFGDPRHAASQAYNTGTGSSRNGINPR
MGAQLTSLNRYSSQIRSWCLAGDNVCAQGTDPGAHTSYFNLFSQEAGAWVKIKV

Enzyme Prediction     

No EC number prediction in FVEG_03351-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	30	232	7.8e-42	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	5.42e-30	30	234	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI63982.1|CE5	2.47e-155	1	234	1	234
CCT68028.1|CE5	2.47e-155	1	234	1	234
QGI81251.1|CE5	2.03e-154	1	234	1	234
CZS83092.1|CE5	1.08e-149	1	234	1	234
QPC60696.1|CE5	5.11e-148	1	234	1	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	2.34e-27	31	234	2	206	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	2.34e-27	31	234	2	206	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	2.34e-27	31	234	2	206	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	3.29e-27	31	230	2	202	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
4PSC_A	4.76e-10	25	209	73	222	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	1.40e-28	1	234	1	233	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	1.60e-27	15	230	17	233	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	1.16e-21	9	234	4	229	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|B9U443|CUTI1_COPCI	4.39e-14	16	234	16	199	Cutinase CUT1 OS=Coprinopsis cinerea OX=5346 GN=CUT1 PE=1 SV=1
sp|O06319|CULP4_MYCTU	6.85e-14	5	234	27	226	Phospholipase Culp4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut4 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999708	CS pos: 18-19. Pr: 0.9819

TMHMM  Annotations     

There is no transmembrane helices in FVEG_03351-t26_1-p1.