CAZyme Information: FVEG_02077-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_02077-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582		63750.15	6.3558

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000583.1:2251393-2253410(+)

Full Sequence      

MAAAAPDSTYDFIICGGGTSGCVVAARLAEDPNVKVLVLEAGPHNEHLENVHMVGGWSNN
FDKETDWNVVSIPGPGVNNRSVKLSRGKFLGGSSGCNGTLMVKGMKQDYDDWNLSGWSGD
DMFKYMLKAENFHTKDWFKETKGAHGYEGHVHTEPHDLAPISNLIGESMVSKGLPLDHDM
FSSGVNPHGCGHSVRTVHQGLRTTSADFITKQKPRDNLHLMVETHVDKVIIEKDSQGELK
ATGVRAVKADGSVVELKASKEVIISSGAYCSPNVLNRSGIGAKVELEQHGITTLVDLPGV
GKNLQDHLIVFMFYETEKEGLTTDSLVYHGNALEKAYTQWKEEKKGPLTVFPFGIFAYAR
MDERLADSKIWNAAPRKEGRDPMGLTPKQPQIEFFTTECYGGPKQYDQFPIDNKHAFSMI
AELFAPKSRGTVTLRDASPTSVPVVDCNYLSDPLDLEVLAEACAFGNEIITEGSGTKDIV
KGSWPSDLVHHKYKTREDWKEYVKDNATTCYHASGSCAAGKKDNPMAVVDEKLQVYGVKG
LRVADCSIMPIVNNGHTQMPAYGIGEKAADLIKERWALSAKL

Enzyme Prediction     

No EC number prediction in FVEG_02077-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	574	4.4e-163	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.10e-96	7	580	3	539	choline dehydrogenase; Validated
225186	BetA	9.05e-94	3	575	1	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.40e-55	11	572	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.77e-35	426	568	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	6.17e-26	77	309	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56109.1|AA3_2	0.0	3	582	2	581
QGI66019.1|AA3_2	0.0	2	582	3	583
CCT70164.1|AA3_2	0.0	2	582	3	583
QGI96901.1|AA3_2	0.0	2	582	3	583
QGI83258.1|AA3_2	0.0	2	582	3	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	5.75e-72	8	573	5	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	8.03e-72	8	573	5	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.12e-71	8	573	5	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	2.98e-65	10	576	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	7.43e-63	10	573	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	5.45e-71	8	573	3	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	1.33e-70	7	577	38	600	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|C3MIE4|BETA_SINFN	6.76e-67	11	572	4	525	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=betA PE=3 SV=1
sp|Q5B8A1|PKFF_EMENI	1.29e-66	7	574	38	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q8UH55|BETA_AGRFC	1.31e-66	11	572	4	525	Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=betA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FVEG_02077-t26_1-p1.