CAZyme Information: FVEG_01778-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_01778-t26_1-p1
• CAZy Family: AA5
• CAZyme Description: chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	CM000583.1|CGC5	24490.91	4.9696

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000583.1:3222342-3223142(+)

Full Sequence      

MHSYSLLTTLALGTAACAYQLPQNLKSIYDNHKAGSCSNRLSDRFPEGARYCGDISGAIY
LKGSNGNYDNMDIDCDGANNHAGACSNDPSGQGETAFKDTVNQYGIPDLDANVHPYVVFG
NDGASPSFDPTQHGIKPLSVMAVVCNGQHYGIWGDTNGGTSTGEASISLAELCFPNQGLN
GDNGHGEKDVLYIAFKGDGAVPGKTGADWKASNRADFSKSIKALGDKLVASLQG

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	8	230	1.9e-82	0.9772727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	1.04e-99	71	231	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI66296.1|GH75	8.33e-161	1	234	1	235
QGI97180.1|GH75	8.33e-161	1	234	1	235
QGI83540.1|GH75	8.33e-161	1	234	1	235
QKD56405.1|GH75	7.18e-151	1	232	1	227
CCT70428.1|GH75	2.68e-145	1	234	1	252

PDB Hits     

FVEG_01778-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	4.92e-104	1	232	1	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q875I9|CSN_ASPFM	1.10e-99	9	233	8	237	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	1.41e-98	11	233	10	240	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	1.02e-94	7	233	6	244	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	1.02e-94	7	233	6	244	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.011147	0.988838	CS pos: 16-17. Pr: 0.9157

TMHMM  Annotations     

There is no transmembrane helices in FVEG_01778-t26_1-p1.