CAZyme Information: FVEG_01619-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_01619-t26_1-p1
• CAZy Family: AA4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505		58398.00	5.8433

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000583.1:3631947-3633464(-)

Full Sequence      

MVATADNSGSYEAIPKTSPQKPSTCKMLHTEGSRIVDPSGNTVILKGAAIGGMLNMENFI
TGYAGHEHQHRQQMAEVMGEEKANFFFDRLLYHFFTDSDAAYFASLGLNCIRIPFNYRHF
IDDMDPDNLKKSGFDWLDRCVDICGRHNLYAVLDLHAVPGGQNQDWHSDSGLSRAAFWDF
KDHQDRAIQLWKALAAHYKGNPVIAGYNLLNEPADESKTSSGHYGAKLIKWYERTEKEVR
AIDPDHMIFIDGNTYAMDFRAFPENPLPNAVYACHDYSLYGFPLPEQYEGTDEQNTKLRK
SFERKVQFMREKNVPIWNGEFGPVYQNEHKEGDEAIKTNAKRFNLLQEQLAIYRETDINW
SIWLYKDVGYQGMVYVDPESPYMRLIAPFIAKKQRLGLDFWGVVNKDGVKHLYEPFLQGL
KEEVLEKYRDTKYPKIWTFERQFERVIRECLMSEYVGWELAELFRDKSMEELEELASSFS
FEKCVKRDTLVGILSHDSMISGAKK

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	71	368	4.2e-129	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	6.97e-27	96	367	26	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	1.61e-16	94	366	73	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI83697.1|GH5_22	0.0	1	505	1	505
QGI66456.1|GH5_22	0.0	1	505	1	505
QGI97343.1|GH5_22	0.0	1	505	1	505
QKD56563.1|GH5_22	0.0	1	505	1	505
CCT70608.1|GH5_22	0.0	1	505	1	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	1.65e-25	94	394	28	342	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	4.17e-25	94	394	28	342	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3W0K_A	4.84e-17	102	366	30	294	Crystal Structure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus],3W0K_B Crystal Structure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus]
7EC9_A	2.40e-16	95	366	37	307	Chain A, Endoglucanase [Thermotoga maritima MSB8],7EC9_B Chain B, Endoglucanase [Thermotoga maritima MSB8],7EFZ_A Chain A, Endoglucanase [Thermotoga maritima MSB8],7EFZ_B Chain B, Endoglucanase [Thermotoga maritima MSB8]
1VJZ_A	5.81e-16	95	366	37	307	Crystal structure of Endoglucanase (TM1752) from Thermotoga maritima at 2.05 A resolution [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	4.18e-173	28	500	4	471	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|P23340|GUNC_CLOSF	6.24e-25	94	394	28	342	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
sp|A3DJ77|GUNC_ACET2	6.24e-25	94	394	28	342	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
sp|P0C2S3|GUNC_ACETH	8.50e-25	94	394	28	342	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
sp|A1CRV0|EXGA_ASPCL	1.26e-14	44	372	41	389	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FVEG_01619-t26_1-p1.