CAZyme Information: FVEG_01488-t26_1-p1

Basic Information

• Species: Fusarium verticillioides
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium verticillioides
• CAZyme ID: FVEG_01488-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		38086.02	4.7348

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fverticillioides7600	16240	334819	371	15869

• Gene Location: location=CM000578.1:1672094-1673336(+)

Full Sequence      

MREVLVARVAYNRIALTVLAAGSSVSARRKDECRVANHIKAVEAKPAAAASSALFELSDF
KPGVEWEIVLHQPIKHDTVADLIPSAAKVWDIDMGLGRDYPEMIPLLKGAGKFVICYFNA
GALQSWNKDIKQFPKAVIGHSLAYPYDSEEWYLDIRDLTVLELQKARLDVAAKIGCDAVD
PDNVDAWQQDGEDPTGFRLKPSDYTKYLKNLAEYAHSINTTDGNRLLVGQKNAPEIAKDL
VSTLDFAVLESCRGTTDPDEENWPFCEDFQAYIDAGKPVLQIEYPHSVEKTGKLSSSDNT
YYCTPKDEDKGFSKILKWASAQLDGWSQFCGDDPFRTPVIKE

Enzyme Prediction     

No EC number prediction in FVEG_01488-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	66	284	7.2e-49	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	9.81e-67	66	317	2	215	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	1.89e-13	70	284	61	266	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
225219	COG2342	3.60e-05	101	284	63	251	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI89288.1|GH114	1.93e-234	9	342	2	335
QGI58377.1|GH114	1.93e-234	9	342	2	335
CCT61950.1|GH114	1.93e-234	9	342	2	335
QGI75595.1|GH114	1.93e-234	9	342	2	335
QKD47958.1|GH114	3.34e-222	9	342	2	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	6.02e-31	63	330	39	277	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	8.67e-31	63	330	56	294	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

FVEG_01488-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000020

TMHMM  Annotations     

There is no transmembrane helices in FVEG_01488-t26_1-p1.